(data stored in ACNUC9543 zone)

EMBL: CP000308.PE476

CP000308.PE476       Location/Qualifiers
FT   CDS_pept        551624..552844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0477"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12445"
FT                   /db_xref="GOA:Q1CAS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR023727"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS7"
FT                   /protein_id="ABG12445.1"
FT                   /translation="MSQDVLADKPLLSRSMVAVLCAQFFSAFGDNALLFATLALIKQQL
FT                   YPDWSQPILQMAFVATYIVLAPFVGQIADGFAKGRVMMVANGLKLAGALVICFGLNPFL
FT                   GYSLVGVGAAAYSPAKYGILGEITSGEQLVKANGMMEASTIAAILLGSVAGGILADWHL
FT                   MAALGVCALVYAIAVIANLFIPRLAAARSGASWRPRAMTGSFFTACRLLWQDSETRFSL
FT                   AGTSLFWGAGVTLRFLLVLWVPVALGIADNATPTLLNAMVAIGIVVGAGAAARFVTLKT
FT                   VKRCLPAGVLIGVMVTIFSLQNSMPMAYLLLIIIGILGGFFVVPLNALLQERGKHSVGA
FT                   GNAIAVQNLGENTAMLFMLGLYSLVVKLGAPVVAVGVGFGVVFALAIALLWGWQWRQQR
FT                   QKTRQPE"
     atgagtcagg acgtattagc agataagcct ttgttatctc ggagcatggt cgcggtactc        60
     tgtgctcagt ttttctccgc tttcggggat aatgccctgc tgtttgccac attggcattg       120
     attaaacagc aactttatcc cgactggagc caacctattt tacagatggc atttgtcgcg       180
     acttatattg ttctggcacc gttcgtcggg cagattgccg atggtttcgc caaaggccgg       240
     gtaatgatgg tggctaatgg tttgaaattg gctggcgctc tggttatctg ttttggttta       300
     aatccgtttc tgggctatag cctggttggg gtgggagcgg cagcctattc accagctaaa       360
     tatggcattc tgggggaaat aacctctggt gagcagttgg tgaaagcaaa cggaatgatg       420
     gaagcctcga cgatcgctgc gatcttactt ggctcggttg ccggggggat actggcagac       480
     tggcatttaa tggccgcatt aggggtttgc gccttggtct atgcgattgc ggtaatagcc       540
     aatttattta ttccacgttt ggccgcagca cgttcaggcg cttcgtggcg tccacgggcg       600
     atgacgggca gcttcttcac cgcttgccgt cttctctggc aggatagcga aactcgcttc       660
     tcattggcgg gtaccagcct gttttggggg gccggtgtga cgttacgctt cctgttagtg       720
     ctgtgggtcc ctgtggcgct tggcattgcc gataatgcga caccaacctt gttaaatgcc       780
     atggtggcga ttgggattgt ggtgggcgcg ggtgccgccg cccgttttgt gacgctaaaa       840
     acagtgaagc gttgtttacc ggctggcgtg ctgattggcg tgatggtcac catcttctcc       900
     ctgcaaaaca gtatgccgat ggcttatttg ctgttaatta tcattgggat tttgggaggg       960
     ttctttgtgg tcccactcaa tgcgctgcta caggagcgtg gtaaacacag cgttggggct      1020
     gggaatgcta ttgccgtaca gaatttgggc gagaataccg cgatgctgtt tatgttgggg      1080
     ctttactcgc tggtggtcaa attaggtgcc cctgttgtgg cggtaggtgt cggttttggt      1140
     gtggtattcg cgctggctat tgctctgtta tggggctggc agtggcggca acagcgccag      1200
     aaaacgcgtc agcctgaatg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page