(data stored in ACNUC9543 zone)

EMBL: CP000308.PE479

CP000308.PE479       Location/Qualifiers
FT   CDS_pept        complement(554972..555151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12448"
FT                   /db_xref="GOA:A0A0H2Y3A6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3A6"
FT                   /protein_id="ABG12448.1"
FT                   /translation="MFSIPQVLYISLILYISLILYISLMLYISLILYIPLFSPLLLCAL
FT                   PPAPVLRYSRIRQV"
     atgttctcta tcccgcaggt gctttatatc tcgctgatac tttatatctc gctgatactt        60
     tatatctcgc tgatgcttta tatctcactg atactttata tcccgctttt ttccccactt       120
     ttactttgcg ctcttccccc tgccccggtg cttcgttata gtcgaataag gcaggtttga       180
//

If you have problems or comments...

PBIL Back to PBIL home page