(data stored in ACNUC9543 zone)

EMBL: CP000308.PE48

CP000308.PE48        Location/Qualifiers
FT   CDS_pept        complement(64258..64710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12017"
FT                   /db_xref="GOA:Q1CC05"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC05"
FT                   /protein_id="ABG12017.1"
FT                   /translation="MSTLEQKLTEIISAPVEALGYELVGIEFIRGRQSTLRIYIDSDDG
FT                   ITVDACADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPMFTAEHYTRYLGEEVTLVLR
FT                   MAMQNRRKWQGIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
     ttgtccacat tagaacaaaa gttaacagag ataatttcag caccggttga agctttaggc        60
     tacgaattag ttggcatcga attcatccgg gggcgccaat cgacgctacg aatttatatt       120
     gatagtgacg acgggatcac tgttgatgct tgtgctgatg tcagccacca ggtcagcgca       180
     gtattggacg tagaagatcc gattacggtc gcttacaact tagaagtttc ctctcctggc       240
     cttgatcgcc caatgttcac ggctgaacat tatactcgtt acctcggcga agaggtcact       300
     ttggttttgc ggatggcaat gcagaatcgc cgtaaatggc agggtattat taaagccgtt       360
     gatggcgaaa tgatcacggt tactgtggat ggaaaagatg aagtgttcgc gctgagcaac       420
     atccagaaag cgaacctggt accccacttt taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page