(data stored in ACNUC9543 zone)

EMBL: CP000308.PE481

CP000308.PE481       Location/Qualifiers
FT   CDS_pept        556626..557153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12450"
FT                   /db_xref="GOA:Q1CAS2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAS2"
FT                   /protein_id="ABG12450.1"
FT                   /translation="MIDDDGYRPNVGIVICNRQGEVLWARRYGQHSWQFPQGGINPGET
FT                   PEQAMYRELFEEVGLNKKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQRWFLLQL
FT                   MCNEAEINMQRSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAATVMPVQEVAP
FT                   PRVPPAYRRKRG"
     gtgatcgatg atgatggcta ccgcccgaat gtgggtattg taatttgtaa tcggcagggt        60
     gaagtattgt gggccaggcg ctatggacag cactcttggc agtttcctca agggggaata       120
     aatcccggtg agacacccga gcaggcgatg taccgtgaac tttttgaaga agtaggattg       180
     aacaaaaagg atgttcggat attggcttca acccgtaatt ggttgcgtta caaattacca       240
     aaacgtttgg tgcgttggga tacaaagccg gtgtgtatcg gccaaaaaca gcggtggttc       300
     ttactacagt taatgtgtaa cgaagccgag attaatatgc aacgtagcag tacaccagaa       360
     tttgatggct ggcgttgggt cagctactgg tatccggttc gtcaagtggt gtcttttaaa       420
     cgtgatgttt atcgtcgtgt aatgaaagaa tttgctgcaa ccgtaatgcc tgtgcaggag       480
     gtcgctcctc cacgggtacc gcccgcttat cgccgtaaaa gaggttaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page