(data stored in ACNUC9543 zone)

EMBL: CP000308.PE49

CP000308.PE49        Location/Qualifiers
FT   CDS_pept        complement(65242..65577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0049"
FT                   /product="protein translocase subunit secG"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12018"
FT                   /db_xref="GOA:A0A0E1NUS6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUS6"
FT                   /protein_id="ABG12018.1"
FT                   /translation="MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGS
FT                   NGSGNFMTRMTAVLATLFFVISLILGNMSSNQGQKSSEWENLGQPLKTEQTATPVAPVK
FT                   PSSDIPQ"
     atgtacgaag ctcttctggt atttttcttg ctgatttcga ttgggctcgt agctcttatc        60
     atgttacagc aaggtaaagg tgcggatatg ggagcctcat tcggagcagg tgcgtctgca       120
     actctgttcg gttcgaatgg ttccggtaac tttatgaccc gcatgacggc tgtattggcg       180
     acgctgtttt tcgtcattag cttgattttg ggaaacatga gctccaacca gggccaaaaa       240
     agcagtgagt gggaaaattt aggtcagcca ctgaaaactg agcagactgc aacgccggta       300
     gcaccagtga aaccgagcag tgatatcccg caataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page