(data stored in ACNUC9543 zone)

EMBL: CP000308.PE496

CP000308.PE496       Location/Qualifiers
FT   CDS_pept        580698..581525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12465"
FT                   /db_xref="GOA:A0A0E1NMY7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMY7"
FT                   /protein_id="ABG12465.1"
FT                   /translation="MSTAYSEAYQQRFGGIARLYGQQALALFSQAHVCVIGIGGVGSWA
FT                   AEALARTGIGAITLIDMDDVCVTNTNRQIHALRHNIGQAKTEVMAERILAINPECHVTC
FT                   IDDFITADNVAELLNKNFSYVIDAIDSVRPKAALLSYCRRYKIPVVTTGGAGGQIDPTR
FT                   IAVVDLAKTIQDPLAAKLRERLKSDFNVVKNSKGKLGIDCVFSSEPLVYPQADGSVCAS
FT                   RSTAEGPKKMDCTSGFGSATMVTATFGFVAVSHVLKKMMAKAARQHESAATAS"
     atgagcacag cctattccga agcttaccaa cagcggtttg gtggtattgc acgcctctat        60
     ggccaacagg cattggcgct tttttcacag gcgcatgttt gtgtcatcgg tattggcggc       120
     gtaggctcat gggcggcgga agcattggcg cgtactggta tcggtgcgat tacactaatt       180
     gatatggatg atgtttgtgt cacgaatact aaccgtcaaa tccatgctct gcgccacaac       240
     atcgggcagg ctaaaacaga agtcatggcc gagcgtattc tggccatcaa tcctgaatgt       300
     catgtgactt gtattgatga ttttattact gcggataatg tcgctgagct tttaaataag       360
     aatttcagct atgttattga tgcaattgat agtgtgcgcc caaaagctgc gctgttgtct       420
     tactgccgtc gctataaaat cccagtggtg actaccggtg gagcgggtgg gcaaattgat       480
     ccaacccgta ttgccgtggt tgatctggct aaaaccatcc aagatccttt agctgcaaaa       540
     ctgcgcgaaa gactgaaaag tgattttaac gtggtgaaaa acagcaaagg taagctaggt       600
     attgactgtg ttttctccag tgagcctttg gtctatccac aagccgatgg ctctgtgtgt       660
     gcatcccgca gcactgccga aggacctaaa aaaatggatt gcacctctgg attcggctcg       720
     gcaacgatgg ttactgccac gtttggcttt gttgctgtgt ctcatgtatt gaagaagatg       780
     atggctaaag cggcccgtca gcacgagtca gccgccactg cgtcataa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page