(data stored in ACNUC9543 zone)

EMBL: CP000308.PE5

CP000308.PE5         Location/Qualifiers
FT   CDS_pept        complement(3995..5482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11974"
FT                   /db_xref="GOA:Q1CC48"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC48"
FT                   /protein_id="ABG11974.1"
FT                   /translation="MHRSLHIRLCLLAALSGESVFLLGPPGIAKSLIARRLKFAFRHAR
FT                   AFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGYLPEAEIVFLDEIWKAGPAILNT
FT                   LLTAINERRFRNGDREDSIPMRLLVTASNELPDADSSLEALYDRMLIRLWLDRVQEKQN
FT                   FRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKITLPDHCFELIFQLRQRLSALEH
FT                   APYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLKDCLWHDLNSFKLLQQQLEQLLT
FT                   EQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVKQSGMFSRKAQYALPDNLTDSTL
FT                   TLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRAKLNGVGYAQSIDAEIDDQLHII
FT                   ILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLAEQRRLFSQHQPCLFTPSSWLAK
FT                   IEASLLQVVEQLQFQQIQFQQIQFQQRKFQQQKHSGH"
     ttgcaccgtt cgttacacat ccgtttgtgc ttactggcag cactcagcgg tgaaagtgta        60
     tttctgcttg gtcctccggg aattgccaaa agcctgattg cccgccgctt gaaatttgct       120
     ttccgccatg ctcgggcatt tgaatacctg atgacccgct tttctacacc ggaagaggtt       180
     tttggcccgc tgtccataca ggcattaaaa gaagaagggc gttaccaacg aatgaccggg       240
     ggttatctac cagaagctga aattgtcttc ctcgatgaaa tctggaaggc gggcccggct       300
     atccttaata ctctactgac cgccattaat gaacggcgct ttcgaaatgg tgatagggaa       360
     gacagtatcc cgatgcgctt gctggtaacc gcgtccaatg agttgccaga cgcagacagc       420
     agcctggaag cactttatga ccggatgctg atccgcctgt ggctagaccg ggtacaagaa       480
     aaacagaatt tccgctcact gctgatcagc agacaaaatg aaaatcacaa cccggtagca       540
     gaaaacctca gtatcactga tgaagaattc caccagtggc agcccttgat tgacaaaatc       600
     acattaccag atcactgctt tgagcttatt tttcagctac gtcaacgact cagcgctctg       660
     gaacacgctc cttatgtctc tgaccgccgc tggaagaagg cattacgtct actacaagcc       720
     agtgcattct tcagtggccg tgatgaaata acccctattg atctgatttt actgaaagat       780
     tgcctatggc atgaccttaa ctcgttcaaa ttactgcaac agcaactgga acaattgttg       840
     acggaacaag ggtatcaaca gcaaagctta ttaatgaagc tacaagatat taatagcaaa       900
     tggttgcaac accaacagca gcaaagtgac caccaggcac tcactgtggt taagcaaagc       960
     ggcatgttca gccgtaaagc gcaatatgct ctgccggata atctgacaga cagtaccttg      1020
     acgctattac tgcaaaaacc gcttaactta catgatattc aggtcaatca tctgcaggtt      1080
     gataaagagg cccttgctca atggctgaat aaaggtggcg ctttacgagc caaattaaat      1140
     ggtgttggct atgcgcaatc tatcgatgcg gaaattgatg atcagttaca tataatcata      1200
     ctggatgtga gccgccagcc atcaaccttg tcccttccgg gtgccacaac cactagcgtg      1260
     ccaccagaac tgctgctggc actcaccaaa ctggaaagta cgctggcaga acaacggcgc      1320
     ttatttagcc aacatcagcc ttgtttattt accccatcat cttggctggc aaaaatagag      1380
     gccagcctgc tacaggtggt ggagcaactt caatttcaac aaattcaatt tcaacaaatt      1440
     caatttcaac aacgtaaatt tcaacaacaa aaacacagtg gacactga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page