(data stored in ACNUC9543 zone)

EMBL: CP000308.PE501

CP000308.PE501       Location/Qualifiers
FT   CDS_pept        585475..586581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12470"
FT                   /db_xref="GOA:Q1CAQ2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAQ2"
FT                   /protein_id="ABG12470.1"
FT                   /translation="MNNKIALYCRSGFEKECAAEITEKAAQLEIFGFARVKENSGYVLF
FT                   ECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGMLVGVIEKAGEL
FT                   RVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRPVVHVFFIAPGCCYVGY
FT                   SYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPADEWEERLASGMHAVDLGAC
FT                   PGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGFKYEPTRSNIYWLVCDMVE
FT                   KPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLAMMDEQLKENGINADIHAK
FT                   QLYHDREEVTVHVRRIWSGAPGRRDERY"
     atgaataata aaattgcttt atattgccgc tccggctttg agaaagagtg tgcggcagaa        60
     ataacagaga aggctgcaca gctcgaaatc tttggttttg cacgggtaaa agaaaacagt       120
     ggctatgtat tgtttgaatg ctaccagtta gaggatgcgg atcgactcat ccgtgaaata       180
     ccgttccgcg agtttatttt cgcccgccaa atgatggtgg tgggggagtt attgaaagac       240
     ttacccccag aagaccgtgt gtcaccgatc gtgggaatgt tggttggcgt tattgaaaaa       300
     gctggcgagt tacgtgttga ggtggccgac accaatgaaa gcaaagagtt actcaaattt       360
     tgccgtaagc tgacggtacc tttgcgtagt gctttgcgtg aacagaaaat tctgtccgct       420
     cgtgagaatg cacatcggcc agtggtgcat gtgttcttta ttgcgccggg ttgttgttat       480
     gttggttatt cttacagcaa taataactct ccattctata tggggatccc tcgacttaaa       540
     ttcccctccg atgcaccaag tcgctcaacc ttaaaactgg aagaggcatt ccatgtattt       600
     atccccgcgg atgaatggga ggagcgttta gccagtggta tgcatgctgt cgatttaggc       660
     gcttgtcccg gtggctggac ttatcaatta gttcaacgca gcatgatgat acaagcggtt       720
     gataatggtt tgatggcaca aagcctgatg gatacggggc aggtcacaca tcaccgtgct       780
     gatggtttta agtatgagcc tacacgcagc aatatttatt ggttagtgtg tgacatggtg       840
     gaaaaaccaa caaaagtcac gcagcttatc accaaatggc tagtcaatgg ttggtgccgt       900
     gaagcgatct tcaacctgaa attaccaatg aaaaagcgtt atgaagaagt tgtacaaaat       960
     ttagcaatga tggatgagca gttgaaagaa aacggtatta atgctgatat ccatgccaaa      1020
     cagctctacc atgatcgcga agaagttacg gtgcatgtcc gtcgtatctg gtcgggtgca      1080
     ccgggccgcc gtgatgagcg ttattag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page