(data stored in ACNUC9543 zone)

EMBL: CP000308.PE506

CP000308.PE506       Location/Qualifiers
FT   CDS_pept        complement(589807..591171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12475"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVU3"
FT                   /protein_id="ABG12475.1"
FT                   /translation="MITHVSPLGSMDLLSQLEVDMLKRTASSDLYRLFRNCSLAVLNSG
FT                   SLTDNSKELLSRNETFDINVLRRERGVKLELVNPPEHAFVDGKIIRSLQANLFAVLRDI
FT                   LFVNGQIVSASNFQHLNMESSSHLTNLVFSILRNARALHIDEEPNMVVCWGGHSINETE
FT                   YLYARKVGSQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQHYKKGRFIGMTEPSIIAA
FT                   EPPNPLVNELVIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPENSEQV
FT                   LPLILTGPKESADYFKVVDEFIMNTLGDGARKYYQIIIDDPDEVARQMKKAMPLVKEYR
FT                   RNTGDAYSFNWSIRIEPDLQHPFEPNHENMANLDLSHNQPPEKLAAALRRAFSGIVAGN
FT                   VKEVGIQAIEAHGPFKLHGDPQLMKQMDRLLQDFIAQHRMKLPGSVYTPCYEICS"
     ttgattacac atgtcagccc gctcggctca atggatctgt tatcacagct cgaagtggat        60
     atgctcaaac gtaccgccag cagtgatttg taccgtttat tccgtaattg ttcactggct       120
     gttctcaatt caggtagcct gaccgataac agcaaagagt tgttatctcg caatgaaacc       180
     tttgatatca acgtgcttcg ccgtgagcga ggagttaaac tcgagttggt caacccacca       240
     gaacatgcgt ttgttgacgg caaaattatt cgctcattac aagcaaacct gttcgcggta       300
     ttacgcgata tcttatttgt caatggtcaa atcgtcagtg cgagcaactt ccagcatttg       360
     aatatggaga gctccagtca tttgactaac ctggtctttt ctattttacg taatgcccgt       420
     gccctacata ttgatgaaga acccaatatg gtcgtgtgct ggggagggca ttcaattaat       480
     gaaaccgagt atttgtacgc ccgtaaagtg ggcagccaac tgggtttgcg tgaattaaat       540
     atctgtaccg gctgtggtcc gggtgccatg gaagccccga tgaaaggtgc cgctgtcgga       600
     catgctcagc aacattataa aaaaggccgt tttatcggca tgacagaacc gtccattatc       660
     gctgcagaac caccaaaccc tctggttaat gaactggtta tcatgcccga tattgagaag       720
     aggctggaag ccttcgtccg aatcgctcat ggcatcatta ttttcccagg tggggtgggc       780
     acagcagaag aattactcta tctattaggg attttgatga atccggaaaa tagtgagcaa       840
     gtgctgccgc tgattttaac cgggccaaaa gagagtgcgg attacttcaa agtggtggat       900
     gagttcatca tgaatacgct gggtgatggc gctcgtaaat actatcagat aattattgat       960
     gacccagacg aagtcgcccg tcagatgaag aaagcgatgc cactggtgaa agagtatcgc      1020
     cgtaataccg gcgatgctta tagcttcaac tggtctattc gtattgaacc agatttacag      1080
     catccgttcg aaccaaacca tgaaaatatg gctaatctgg atctgtctca taatcaacca      1140
     ccggagaaac tggccgccgc attacgccgg gcgttttctg ggattgtggc aggtaatgtc      1200
     aaggaagtgg gtatccaggc tattgaagcg catgggccat ttaaactgca tggcgatccg      1260
     caattaatga agcaaatgga ccgcctactg caagatttta ttgctcaaca tcggatgaag      1320
     ttaccaggta gcgtctatac accttgctat gaaatttgta gctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page