(data stored in ACNUC9543 zone)

EMBL: CP000308.PE510

CP000308.PE510       Location/Qualifiers
FT   CDS_pept        594254..594586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12479"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTR7"
FT                   /protein_id="ABG12479.1"
FT                   /translation="MSTENKVRQSLQDIEFAMRETDLWQTVPPEAEAFESNEPFSIDTM
FT                   AAEQWLQWVFLPRMYALLELNGPFPTRFAITPYFEEALSGDGRPDYSALLAQLRCLDDL
FT                   LNKESE"
     atgagtacag aaaataaggt gcgtcaaagc ttacaggata ttgagtttgc catgcgagag        60
     actgacctct ggcaaaccgt cccaccggaa gcagaagctt ttgagagtaa cgagcctttt       120
     agtattgata ctatggcggc agagcagtgg ctacagtggg tgtttctccc ccggatgtat       180
     gcattgctgg agctaaatgg cccgttcccc acccgttttg ctattacgcc gtattttgaa       240
     gaggctctga gcggtgatgg gcggccagat tactcggcgc ttttggcaca attacggtgc       300
     cttgatgatc tgttgaataa agaaagtgaa taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page