(data stored in ACNUC9543 zone)

EMBL: CP000308.PE512

CP000308.PE512       Location/Qualifiers
FT   CDS_pept        595387..595836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12481"
FT                   /db_xref="GOA:A0A0E1NT02"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT02"
FT                   /protein_id="ABG12481.1"
FT                   /translation="MAQVGIFVGTVYGNALLVAEEAENILKDQGHEVKLFDEGTLEDWQ
FT                   HYRQHYVLVITSTTGQGDFPDSIASLFVAVRDQVGFQPELRYGVIALGDSSYDNFCGAG
FT                   RTFDELLQEQGATRIGERLEIDAIEHSEPEAISAPWVEQWGRLLQ"
     atggctcaag ttgggatttt tgttggtact gtctatggta atgcgttgtt agtggcagaa        60
     gaagctgaga acatcttgaa agatcaaggg catgaggtaa agttatttga cgaaggcacg       120
     ttagaggact ggcagcatta ccgtcaacat tatgtgttgg tcattacctc aaccaccggg       180
     cagggcgatt tcccagatag catcgcatca ctatttgttg ctgttcgtga tcaggtgggg       240
     ttccaacccg agttacgcta tggtgtcatt gcgctcggcg acagtagcta tgataatttc       300
     tgcggtgctg ggcgtacgtt cgatgagcta ttgcaggagc agggcgcgac acggattggc       360
     gaacggttag agattgatgc tattgagcac tcagaaccag aggcgatatc tgcgccatgg       420
     gtggaacaat gggggcgttt gcttcagtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page