(data stored in ACNUC9543 zone)

EMBL: CP000308.PE515

CP000308.PE515       Location/Qualifiers
FT   CDS_pept        complement(597438..600119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0516"
FT                   /product="(protein-PII) uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12484"
FT                   /db_xref="GOA:Q1CAN8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN8"
FT                   /protein_id="ABG12484.1"
FT                   /translation="MSDNHTEHSLSLTLTPTISEQPALPSTYLDSDIHCPILKQRLDAF
FT                   QRWQAEAFNSGTSAEVLIAARSDYIDHLLQRLWTFYGFDKVPETALVAVGGYGRGELHP
FT                   LSDIDVLVLSKQRLNDEQAQRVGQLITLLWDLKLEVGHSVRTLEECLLEGLADLTIATN
FT                   MIESRLICGDVALFLQMQKHIFSDSFWPSPQFFHAKVVEQQERHKRYHGTSYNLEPDIK
FT                   SSPGGLRDIHTLLWVARRHFGATSLSEMVDFGFLTNAERNELNESQSFLWRIRFALHLV
FT                   LTRYDNRLLFDRQLSVAQLLRYEGEGNEPVEHMMKDFYRMTRRVSELNNMLLQLFDEAI
FT                   LALDANEKPRPLDEEFQLRGDLIDLRDENLFVRQPEAIMRMFYLMVRNQDIKGIYSTTV
FT                   RRLRHARRHLKAPLCHIPEARKLFMAILRHPGAVSRALLPMHRHSVLWAYMPQWGSIVG
FT                   QMQFDLFHAYTVDEHTIRVLLKIESFADEDTRPRHPLCVELYPRLPQPELLLLAALFHD
FT                   IAKGRGGDHSILGAHDAVEFAEQHGLNSRESQLVAWLVRCHLLMSVTAQRRDIQDPAVI
FT                   QQFSAEVQSETRLRYLVSLTVADICATNENLWNSWKQSLLRELYFATEKQLRRGMQNSP
FT                   DLRERVRHHRLQALALLRMDNIDEEALHRIWSRCRADYFLRHSPNQLAWHARHLLEHDS
FT                   TKPLVLVSRQATRGGTEIFIWSPDRPSLFAAVVGELDRRNLSVHDAQIFTNRDGMAMDT
FT                   FIVLEPDGSPLAQDRHPIISHALQQAINRSDYQHPPRVRRLSPKLRHFSVPTEANFLPT
FT                   HNERRTYLELIALDQPGLLARVGKIFADLGLSLHSARITTIGERVEDLFVLADKDRRAL
FT                   SLETRRELAQRLADTLNPNDKL"
     atgtctgaca atcacaccga acactcccta tcgctgacgc tcactcccac tatttctgag        60
     cagcccgcac ttcccagcac ttatcttgat agcgacatcc attgcccgat actgaagcaa       120
     cggcttgacg ctttccaacg ctggcaggca gaggcattta atagtggcac ctctgccgag       180
     gtattaattg cggcacgcag tgattatatc gatcatctgt tacagcggtt gtggacattc       240
     tatggttttg acaaggtgcc agaaacagct ctggttgcgg tcggtggcta tgggcgcggc       300
     gaactgcatc cattatcaga tattgatgtg ttagtactga gtaagcagcg tctaaatgat       360
     gaacaggcgc aacgggttgg ccaactcatt accttattgt gggatttgaa gctggaagtc       420
     ggtcatagtg tgcgcacact ggaagagtgc ttgctggaag gcctcgcaga tttaaccata       480
     gccaccaata tgattgagtc acggttgatt tgcggtgatg tcgccctttt tttacagatg       540
     caaaaacata ttttcagtga cagtttctgg ccctcccctc aatttttcca tgcaaaagtt       600
     gttgaacagc aagagcgtca taaacgctat cacggcacca gctataatct ggaacccgat       660
     atcaaaagta gccctggtgg attacgggat atccacacat tactctgggt tgcccgtcgc       720
     catttcggtg cgacatcgtt aagtgaaatg gttgattttg ggtttctcac caacgccgag       780
     cgtaatgaac tgaatgaaag ccagagtttt ttatggcgta tccgttttgc gctgcacctg       840
     gtattgactc gctacgataa ccgcctgctg tttgaccgcc aactgagcgt tgctcaactt       900
     ttacgctacg aaggtgaagg caatgagccc gttgaacata tgatgaaaga tttctatcgt       960
     atgacaaggc gtgtcagtga actgaacaat atgctgctgc aattgtttga tgaagccata      1020
     ctggcattag atgcgaatga aaaaccgcgt ccacttgacg aagagtttca actacgggga      1080
     gatttaattg atctccgtga tgagaaccta tttgttcgtc agcctgaagc gatcatgcgg      1140
     atgttctatc tgatggtgcg caatcaggat attaaaggta tttactccac taccgtccgg      1200
     cgtttgcgcc atgcccgtcg tcatctgaaa gcccctttat gtcacattcc tgaagctcgt      1260
     aaactgttca tggccatttt gcgccacccc ggtgccgttt cacgtgcgtt gctgcccatg      1320
     catcgtcaca gtgttttatg ggcctatatg ccgcaatggg gcagtattgt tggccaaatg      1380
     caatttgatc tatttcatgc ttatacggtg gatgaacaca ccatccgtgt tttgctaaaa      1440
     attgaaagct tcgcggatga agatacccgg ccacgtcatc cactctgcgt cgaactctac      1500
     cctcgcctgc ctcagcctga attactgctg ctggccgccc tgtttcatga tattgccaaa      1560
     gggcgtggcg gtgatcattc aatactgggt gcccacgacg cggtggagtt tgctgaacag      1620
     catgggctta attcacgcga atcccaatta gtcgcttggt tagttcgctg ccatttattg      1680
     atgtcagtga ccgcccaacg tagggatatt caggacccgg ccgttattca gcaattttct      1740
     gccgaagtgc aaagtgaaac gcgcctgcgc tatctggtca gcctgaccgt ggcagatatt      1800
     tgcgccacca atgaaaatct atggaatagc tggaaacaga gcctgttacg cgaactgtac      1860
     tttgcgaccg aaaaacagct acgccgcgga atgcaaaata gccctgattt acgtgagcgt      1920
     gtacgccacc accgcctgca agcgttagct ctactgcgga tggataatat tgatgaagag      1980
     gcactgcatc gtatctggag ccgttgccga gcggattact tcctacgcca ctcgccgaat      2040
     caacttgcct ggcacgcccg ccatttgctg gagcacgact caaccaaacc gctagtctta      2100
     gtcagccgtc aggctacccg tggtgggact gaaatattta tctggagccc tgaccgccca      2160
     tcactctttg ccgctgttgt tggggagctt gatcgccgca acttgagcgt ccatgacgca      2220
     caaattttca ccaatcgtga tggtatggcg atggatacct ttattgtatt ggagccagat      2280
     ggcagcccgt tggcacagga taggcatcca ataatcagcc atgcattaca gcaagcgata      2340
     aaccggtcag attaccaaca cccgccgcgg gttaggcgat tatcacctaa attacggcat      2400
     ttcagcgtgc caaccgaagc taacttttta ccaacccata acgagcggcg tacttatctg      2460
     gaattaattg cgttagatca accagggtta ctggcacgtg ttggcaaaat ttttgctgat      2520
     ttagggttat cactgcacag tgcacgtatc accaccatcg gcgagcgagt agaggattta      2580
     tttgttttag cagataaaga tcgtcgagca ctgagccttg aaacccgtcg tgaattagca      2640
     caacgattgg cagatactct caatccaaac gataaactgt ga                         2682
//

If you have problems or comments...

PBIL Back to PBIL home page