(data stored in ACNUC9543 zone)

EMBL: CP000308.PE517

CP000308.PE517       Location/Qualifiers
FT   CDS_pept        601405..602130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0518"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12486"
FT                   /db_xref="GOA:Q1CAN6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN6"
FT                   /protein_id="ABG12486.1"
FT                   /translation="MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELTKISSRKGKILFVGTKRAASEAVKEAANNCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEIQSQDGTFDKLTKKEALMRTRELNKLENSLGGIKDMGGLPDALFV
FT                   VDADHEHIAIKEANNLGIPVFSIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVR
FT                   EGRSQDLAVQAEESFVEAE"
     atggcaactg tttccatgcg cgacatgctc caggctggtg ttcactttgg tcaccaaacc        60
     cgttactgga acccgaaaat gaagcctttc atcttcggcg cacgtaacaa agttcacatc       120
     atcaacctgg aaaaaactgt accaatgttc aacgaagctc tggctgagtt gactaaaatt       180
     tcttcccgta aaggtaagat cctgtttgtt ggtactaaac gcgcagcaag cgaagcggta       240
     aaagaagctg ctaacaactg cgaccagttc ttcgtgaacc atcgctggtt gggcgggatg       300
     ctgactaact ggaaaactgt tcgtcagtcc atcaaacgtt tgaaagattt ggaaatccag       360
     tctcaagacg gcacctttga taagctgacc aaaaaagaag cgctgatgcg tacccgtgaa       420
     ctgaacaagc tggaaaacag cctgggtggt atcaaagaca tgggcggctt accagacgca       480
     ctgtttgttg ttgatgctga tcacgaacac atcgctatca aagaagctaa taacctgggt       540
     atcccggtat tctctatcgt tgatactaac tccgatccag atggcgttga cttcatcatc       600
     cctggtaacg atgacgcaat ccgtgcagtt aaactgtacc taggcgctgt tgctaccgcc       660
     gtccgtgaag gtcgttctca agatctggcc gttcaggcgg aagaaagctt cgtagaagct       720
     gaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page