(data stored in ACNUC9543 zone)

EMBL: CP000308.PE52

CP000308.PE52        Location/Qualifiers
FT   CDS_pept        complement(68103..70037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0052"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12021"
FT                   /db_xref="GOA:A0A0E1NRW5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRW5"
FT                   /protein_id="ABG12021.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFMSDVTQDQ
FT                   VREARINGREINVSKKDNSKYTTFIPVNDPKLLDTLLTKNVKVVGEPPEEQSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTSFADVAGCDEAKEE
FT                   VSELVDYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   DTDIDASVIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RQKLESQISTLYGGRLAEEIIYGPEKVSTGASNDIKVATSIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEIFLGRSVAKAKHMSDETARIIDQEVKLLVERNYQRARKLLLENMDVLHSMKD
FT                   ALMKYETIDAPQIDDLMNRKEVRPPAGWDNVTKNKSSDNDNTPTATMPADEPNTPTSGN
FT                   TVSEQLGDK"
     atggcgaaaa acctaattct ctggttagtt attgcagtcg tcttgatgtc tgtattccag        60
     agctttggtc ccagcgaatc gaatggccgt agagtggatt actctacttt catgtccgac       120
     gtaacccaag atcaagtgcg tgaagcacgt atcaacggac gtgaaattaa cgttagtaag       180
     aaagataaca gcaaatatac gacttttatt ccggtcaatg atccaaagct gctagatacc       240
     ttattgacta aaaatgtgaa agttgttggt gagcctccag aagagcaaag cttactggca       300
     tctatcttta tatcttggtt cccaatgttg ttattgattg gggtctggat cttctttatg       360
     cgtcaaatgc agggcggcgg tggcaaagga gcaatgtcct ttggtaaaag caaagctcga       420
     atgctgacgg aagatcagat aaaaacctcg tttgctgatg ttgctggttg tgacgaagca       480
     aaagaagagg tcagtgaatt agttgactac ctgcgtgagc caagccgttt ccagaaattg       540
     ggcggtaaaa ttcctaaagg cgtgttgatg gtaggccctc cggggacggg taaaaccttg       600
     ctggcgaaag ccattgcagg tgaagctaaa gtgccattct tcacaatttc tggttctgac       660
     ttcgtagaaa tgttcgttgg tgtcggtgca tcccgtgtcc gtgacatgtt tgaacaggct       720
     aaaaaagctg cgccttgtat catcttcatt gatgaaatcg atgcggttgg ccgtcaacgt       780
     ggcgctggtc tgggtggggg tcatgacgaa cgtgaacaga cgctgaacca aatgctggtt       840
     gaaatggatg gcttcgaagg taatgaaggc atcattgtta ttgcggcaac taaccgccca       900
     gacgttctgg atcctgcgtt attgcgccca ggccgttttg accgtcaggt tgtcgttggt       960
     ttacctgatg ttcgtggtcg tgaacaaatt cttaaagttc acatgcgccg tgtgccatta      1020
     gataccgata ttgatgcttc agtgatcgct cgtggtactc caggcttctc tggtgctgat      1080
     ttggcgaacc tggtaaacga agctgcattg tttgccgccc gcggtaacaa acgcgttgtt      1140
     tctatggttg agttcgaaaa agcgaaagac aaaattatga tgggtgcgga acgtcgctcc      1200
     atggtaatga cagaagcgca gaaagaatct acggcctacc atgaagcagg gcatgccatt      1260
     attggtcgtt tagtgccaga gcatgatcca gtgcataaag tgacgatcat tcctcgtggc      1320
     cgtgctctgg gtgtcacctt cttcttgccg gaaggcgatg caatcagtgc tagccgccag      1380
     aagttggaaa gtcagatttc taccttgtac ggtggtcgtc ttgcagaaga gatcatttat      1440
     ggcccggaaa aagtgtctac cggtgcttcg aatgatatca aagtggcaac gtctattgcg      1500
     cgtaacatgg taacgcagtg gggcttctcc gaaaaactgg ggccgttgct gtatgctgaa      1560
     gaagagggcg aaattttcct cggccgttct gtagcgaaag ctaagcatat gtctgatgag      1620
     actgcgcgta tcatcgatca ggaagttaaa ttacttgttg agcgtaacta tcagcgtgca      1680
     cgtaaattgc tgttagaaaa tatggatgtt ttacactcca tgaaagacgc gttgatgaag      1740
     tatgaaacta ttgatgcgcc acagattgat gacttgatga atcgcaaaga agttcgcccg      1800
     ccagcgggtt gggacaatgt gaccaaaaat aaatcatctg acaatgacaa tacaccaacg      1860
     gcaaccatgc cggctgatga accgaatact ccaacgtcgg gcaatacagt gtcagaacag      1920
     ttgggtgata agtaa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page