(data stored in ACNUC9543 zone)

EMBL: CP000308.PE521

CP000308.PE521       Location/Qualifiers
FT   CDS_pept        604034..604759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0522"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12490"
FT                   /db_xref="GOA:Q1CAN2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAN2"
FT                   /protein_id="ABG12490.1"
FT                   /translation="MATNAKPVYQRILLKLSGEALQGAEGFGIDASVLDRMAQEVKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAQAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRHNRVVIFAAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVYSADPVKNPDATLYEQLTYQDVLEQELKVMDLAAFTLARDHNLPIRVFNMNK
FT                   PGALRRVVMGENEGTLIAK"
     atggcaacca atgcaaaacc cgtatatcag cgtatcctgc ttaagctgag tggcgaagcc        60
     ctgcaaggcg cagaaggttt cggtatcgac gctagcgttt tggaccgcat ggctcaggaa       120
     gttaaagagc tggttgaatt gggcattcag gtcggtgtag tcattggcgg tggtaactta       180
     ttccgcggtg ccggtttggc acaggctgga atgaaccgtg tcgtgggcga ccacatggga       240
     atgctggcga ctgttatgaa tggtctggca atgcgagatg ctttgcaccg tgcctatgtg       300
     aacgcccgcc taatgtctgc tattccactt aatggcgttt gtgataatta cagttgggcc       360
     gaagcgatta gcttgctgcg tcataaccgt gtggttattt ttgctgcggg taccggtaac       420
     ccattcttta cgacggattc tgctgcgtgt ctacgtggta tagaaattga agccgatgtt       480
     gtgttaaaag caacaaaggt tgatggggtt tactccgcag atccggtgaa aaatcctgac       540
     gcaacattgt acgaacagtt aacctatcag gatgttttag aacaagagtt gaaagttatg       600
     gatctggcgg ccttcacttt ggcccgtgac cataacctgc caattcgggt cttcaacatg       660
     aataaacccg gcgctttgcg tcgtgtggtg atgggtgaga atgaagggac attgatcgct       720
     aaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page