(data stored in ACNUC9543 zone)

EMBL: CP000308.PE527

CP000308.PE527       Location/Qualifiers
FT   CDS_pept        610123..612510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0528"
FT                   /product="putative surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12496"
FT                   /db_xref="GOA:Q1CAM6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAM6"
FT                   /protein_id="ABG12496.1"
FT                   /translation="MAMKKLLIASLLFGSATVYGADGFVVNDIHFEGLQRVAVGAALLN
FT                   MPVRVGDTVSDDDIGKTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKA
FT                   VKEDMLKQNLEASGVRVGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFTEGVSAKIQQINIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYVTINITEGPQFKLNSVIVSGNLAGHQ
FT                   SEAEKLTKIEPGELFNGSKVTRMEDDIKKMLGRYGYAYPRVVTQPEINDDDKTVKLHIN
FT                   VDAGNRFYVRHIRFEGNDTSKDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVD
FT                   VETQRVPGAADLVDVTYKVKERNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGI
FT                   NGTKNDYQTYAEFTLMDPYFTVDGVSLGGRIFYNDFKADNADLSGYTNSSYGADGTLGF
FT                   PINENNSLRVGVGYVHNDLSDMLPQVAMWRYLESVGERPGYDGREGFTTDDFTLNLGWT
FT                   YNNLDRGFFPTSGVKSSVNTKITVPGSDNEFYKVTFDTSAYQPLNEDRSWVLLGRGRLG
FT                   YGDGIGSKEMPFYENFYAGGSSTVRGFRSNNIGPKAAYYANGGATVTNSTDAVGGNAMA
FT                   VASIELITPTPFISEKYSNSVRTSIFIDSGTVWDTNWENTAKTRAAGIPDYGKASNIRV
FT                   SAGVALQWMSPLGPLVFSYAKPVKDYEGDKSEQFQFNIGKTW"
     atggcgatga aaaagttgct catagcgtcg ctgctgtttg gcagcgccac cgtatacggt        60
     gcagacgggt tcgtagtgaa cgatattcat ttcgaaggac tgcaacgggt cgccgtcggt       120
     gcggcgttac ttaatatgcc ggttcgcgta ggcgataccg tcagtgatga tgacatcggt       180
     aaaactatcc gtgcgttgtt tgctacaggc aacttcgagg acgttcgcgt cctgcgcgat       240
     ggtaatacgc tgattgttca agtcaaagaa cgccccacga ttgccagcat cactttctcc       300
     ggtaataaag cggtgaaaga agatatgctc aagcagaatc tggaagcctc tggcgtccgg       360
     gttggcgagg ccttggaccg aaccactata tccaacattg aaaaaggact cgaagatttc       420
     tattacagtg tgggtaaata cagcgcttca gtgaaggctg ttgttacgcc attaccacgt       480
     aatcgtgttg acctgaaatt ggtctttacc gaaggtgttt ctgcaaaaat tcagcagatt       540
     aatatcgtag gtaatcacag tttcaccact gatgagctta tctcacgctt ccaactgcgt       600
     gacgaggtgc cttggtggaa cgtagtcggt gatcgtaaat atcagaaaca gaaactggca       660
     ggtgaccttg aaaccttgcg cagcttctat ttagaccgcg gttatgcgcg ctttaatatc       720
     gattcaactc aggtgagttt gacgccagat aaaaaaggca tctatgtcac catcaatatt       780
     actgaaggcc cacaattcaa gctaaatagt gtgattgtga gcggcaatct tgcagggcat       840
     caatctgaag ctgagaagct gacaaaaatt gagccgggtg agttgtttaa cggcagtaaa       900
     gtgacacgta tggaagatga catcaaaaag atgttgggcc gttacggcta tgcttaccca       960
     cgtgttgtca ctcagccaga aattaatgat gacgataaaa cagttaaact gcatatcaac      1020
     gtggatgcag gtaaccgttt ctatgtccgc catattcgtt tcgaaggtaa cgataccagt      1080
     aaagactcgg tgttgcgccg tgaaatgcgc cagatggaag gtgcatggtt gggcaatgat      1140
     caggtagaag cgggtaaaga gcgacttaac cgtttgggtt acttcgagac cgttgatgtt      1200
     gagactcaac gtgtaccggg agctgccgat ctggttgatg tgacctataa agtgaaagaa      1260
     cgaaacacgg gcagcctgaa ctttggtatt ggttatggta ccgagagcgg ggtgagtttc      1320
     caggttggcg ttcagcaaga taactggcta ggcaccggta ataccgtggg tattaacggc      1380
     acaaagaacg attatcagac gtatgcagaa tttacgctaa tggaccctta cttcactgtt      1440
     gatggtgtaa gtctgggtgg gcgtattttc tacaatgact ttaaagcgga taatgcagat      1500
     ttatctggct ataccaacag tagctatggt gccgacggta ctcttggctt cccaattaat      1560
     gagaataact cattacgtgt tggtgtcggt tatgtccata acgatctgtc tgacatgtta      1620
     ccgcaagttg cgatgtggcg ttatcttgaa tcagtgggtg agcgcccggg ctatgatgga      1680
     cgtgaaggtt tcactactga tgacttcact ctgaatctag ggtggacata taacaacctt      1740
     gaccgtggtt tcttcccaac atcgggggtt aaatcatcgg tgaacacgaa aattaccgtg      1800
     ccaggctcag ataatgagtt ctacaaagtg actttcgata catcagctta ccagccatta      1860
     aatgaagatc gttcgtgggt gctcttaggc cgtggtcgct taggttatgg tgacggtatt      1920
     ggttcgaaag agatgccatt ctacgaaaac ttctatgcag gtggttccag cacggttcgt      1980
     ggtttccggt cgaataacat tggtccaaaa gcggcgtatt acgctaatgg tggggctaca      2040
     gtgactaact ctaccgatgc ggtagggggt aatgcgatgg cggtggccag tatcgagttg      2100
     atcacaccga caccgtttat cagcgagaaa tactcgaatt cagtgcgtac ctccatcttt      2160
     atcgactcag gtactgtgtg ggataccaat tgggaaaaca cagctaaaac gcgtgctgca      2220
     ggtattcctg attacggtaa agcgagtaat attcgtgtgt ctgcgggtgt agcattgcaa      2280
     tggatgtctc cattgggtcc attggtgttc tcatatgcta aaccagttaa agattacgaa      2340
     ggtgataagt cagagcaatt ccagtttaac attggtaaaa cttggtaa                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page