(data stored in ACNUC9543 zone)

EMBL: CP000308.PE53

CP000308.PE53        Location/Qualifiers
FT   CDS_pept        complement(70094..70723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0053"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12022"
FT                   /db_xref="GOA:Q1CC00"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC00"
FT                   /protein_id="ABG12022.1"
FT                   /translation="MSNKKRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQS
FT                   DKLFKQGMTVVDLGAAPGGWSQYAVTQIGSKGRVIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMYLVELALDMCRDVLAPGGSFLV
FT                   KVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
     atgtctaata aaaagcgttc ggctagctcc agtcgctggt tacaagaaca ctttagcgat        60
     aaatatgtaa ttcaggcaca gaaaaagggg ctacgctctc gtgcctggtt taaacttgat       120
     gaaatacaac agagcgataa actttttaaa cagggtatga cagttgttga cctaggtgca       180
     gcccctggtg gttggtccca atatgctgta acccagattg gcagtaaagg gcgagttatc       240
     gcatgtgatc ttctaccaat ggatcctatc gttggtgtcg atttccttca gggcgatttt       300
     cgtgatgaac tggtcctgaa agctttactt gagcgcgttg gggataaaaa agttcaggtg       360
     gtcatgtgtg atatggcccc gaatatgagt ggtactccgg cagtcgatat acctaaatca       420
     atgtatctgg ttgaattagc tttagatatg tgtcgtgatg tacttgcacc aggtggaagt       480
     ttcctggtga aggtgttcca gggagatggc tttgatgaat acctacggga aattcgctcc       540
     ctgtttacga aagttaagat tcgtaagcca gacgcttctc gtgcgcgatc gcgtgaagta       600
     tacattgtag cgacagggcg gaaactgtag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page