(data stored in ACNUC9543 zone)

EMBL: CP000308.PE534

CP000308.PE534       Location/Qualifiers
FT   CDS_pept        617582..621097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0535"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12503"
FT                   /db_xref="GOA:A0A0H2Y481"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y481"
FT                   /protein_id="ABG12503.1"
FT                   /translation="MIQSTHFWYLDMAEPRFVHLRVHSDYSMIDGLAKIGPLVKRAAAL
FT                   GMPALAITDFTNLCGLVKFYGSAHGAGIKPIIGADFYVQSEILGDELAHLTVLARNNEG
FT                   YQNLTLLISEAYQRGYGAAGPIIDRDWLIKHKEGLILLSGGRMGDVGKFLLRGNQVQVD
FT                   QCLAFYQEHFPDCYYLELIRTGRPDEENYLHAAVALATERGLPVVATNDVRFIDESDFD
FT                   AHEIRVAIHDGFTLVDPKRPKNYSPQQFMRDEEQMCELFADIPEALINSVEIAKRCNVT
FT                   IRLGEYFLPQFPTGEMSTEDFLVEKAKQGLEERLEFLFPDPEVRLQKRPEYDERLDIEL
FT                   KVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDIDPLEFDLLF
FT                   ERFLNPERVSMPDFDVDFCMEKRDLVIEHVAEMYGRDAVSQIITFGTMAAKAVIRDVGR
FT                   VLGHPYGFVDRISKLIPLDPGMTLEKAFAAEPQLAEIYEADEEVRALIDMARKLEGVTR
FT                   NAGKHAGGVVIAPTKITDFAPLYCDAEGNNPVTQFDKNDVEYAGLVKFDFLGLRTLTII
FT                   NWALEMINARRAKTGLEPIDIASIPLEDKKSFDMLQRSETTAVFQLESRGMKDLIKRLK
FT                   PDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREAISYPDIEWQHESLKPVLEPTYGI
FT                   ILYQEQVMQIAQVLSGYSLGGADMLRRAMGKKNPAEMAKQRSVFEDGAKNQGIDGELAI
FT                   KIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTDKVVGLV
FT                   DECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAILEARKEGGYFK
FT                   ELFDLCARVDTKKLNKRILEKLIMSGAFDRLGPHRAALMSSLGDALKAADQHAKAEAIG
FT                   QVDMFGVLADAPEQVEQSYANVPPWQEQVVLDGERETLGLYLTGHPITQYLKEIERYAG
FT                   GMRLKDMHPTDRGKMTTAVGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALEK
FT                   YQHLLEKDRILIATGQVSFDDFSGGLKMTARELMDISEAREKYASGLAISLTDRQIDDQ
FT                   LLNRLRQSLEPHRAGTIPVHLYYQREDARARLRFGATWRVTPTDRLLIDLRTLVGNEQV
FT                   ELEFD"
     atgattcaat ccactcattt ctggtatttg gatatggccg aacctcgttt tgtccacctg        60
     cgtgttcata gcgattattc catgatcgat ggattagcta agattggacc tttggtgaaa       120
     agagctgctg cattaggtat gcctgctctg gctattaccg attttactaa cctctgtggc       180
     ctggtgaaat tctacggcag cgcgcatggt gcggggatta aacccatcat cggtgctgac       240
     ttctacgtac aaagtgaaat actgggtgat gaattagctc acctcacggt tttggctcgc       300
     aataatgaag gctatcaaaa tctgacttta ttgatctcag aagcctacca acggggttat       360
     ggcgctgcgg gtcctatcat tgatcgcgat tggctgatca aacataaaga aggactcatt       420
     ctgctgtctg gtggccgaat gggggatgtg ggcaaatttc tgctacgggg taaccaggtt       480
     caggttgatc aatgtctcgc cttttatcag gaacactttc cagactgcta ttacctcgaa       540
     cttattcgaa ccgggcgtcc agacgaagaa aactatcttc atgctgccgt ggcattggcc       600
     actgagcgtg gtttacctgt cgttgcgacc aatgatgtgc gttttattga tgaatcggat       660
     tttgatgccc atgaaatccg tgtcgctatc catgatggtt ttacattggt cgatcctaaa       720
     cggccgaaga attacagccc tcagcagttt atgcgcgatg aagaacagat gtgtgagctg       780
     ttcgctgata ttccagaagc gttgatcaac agcgttgaga tagccaaacg ctgtaatgtc       840
     actattcgcc ttggggaata tttcttaccg cagttcccca caggggagat gagtacagaa       900
     gattttctgg tagaaaaagc caaacaaggt ttggaagaac gtttggaatt tctgtttccg       960
     gaccctgagg ttaggctgca aaaacggcca gaatatgatg aacgtctgga tatcgagctc      1020
     aaagttatca accaaatggg cttccctggt tacttcctga ttgtaatgga gtttatccag      1080
     tggtcgaaag ataacggcgt accggtgggg ccggggcgtg gctctggtgc aggctcattg      1140
     gtggcttatg ccctgaaaat tactgatatt gacccactgg aatttgatct actgttcgag      1200
     cgcttcctta atccggaacg tgtatcgatg cctgacttcg acgttgactt ctgtatggag      1260
     aaacgtgatc tggtgatcga acacgtggcg gaaatgtatg gccgcgatgc ggtttcccag      1320
     ataattacct tcggtaccat ggcggctaaa gcggtcatcc gcgatgtcgg ccgtgtatta      1380
     ggccatccct atggctttgt tgatcggatc tcaaaattaa tcccactcga tccggggatg      1440
     acactggaaa aagcgtttgc agcggagcca cagctagctg aaatttatga agctgatgaa      1500
     gaggtcaggg cgctaattga tatggcgcgt aagctggaag gagtaacgcg aaacgccggg      1560
     aaacatgctg gaggcgtggt tattgccccc actaagatta ccgattttgc cccactctat      1620
     tgtgatgcgg aaggcaataa cccagttacg cagtttgata aaaatgatgt ggaatatgct      1680
     gggctggtga agtttgactt cctcggtcta cgtacactaa ccatcattaa ttgggcgttg      1740
     gagatgatta acgcccggcg cgctaaaact ggattggaac ccattgatat cgcctctatt      1800
     ccgctggagg ataaaaaaag cttcgatatg ctgcaacgtt cggaaacgac agcagtattc      1860
     cagctggaat ccagagggat gaaagacttg atcaagcgcc tgaagcccga ctgcttcgag      1920
     gacatgatcg ccttagtggc gttatttcgt cccggtccgt tacaatcagg gatggttgat      1980
     aactttattg accgtaaaca cggccgggaa gcgatatctt acccagatat tgagtggcaa      2040
     catgaatcct tgaaacctgt gcttgagccg acctacggca ttatcttgta tcaggaacag      2100
     gtcatgcaaa ttgcgcaggt tctgtccggc tactcactgg gtggtgcgga catgttgcgt      2160
     cgtgccatgg gtaagaaaaa ccctgctgag atggctaagc agcgttctgt atttgaagat      2220
     ggtgcgaaaa atcagggtat tgatggtgag ctggcgatta aaatctttga cctggttgag      2280
     aaatttgcag gttacggttt taacaaatct cactcggcag cttatgcatt agtctcctat      2340
     caaacgttgt ggttaaaagc ccattatccg gctgaattta tggctgcagt aatgaccgct      2400
     gatatggata atacggacaa agtggtcggc ttggtcgatg aatgctggcg tatggggctg      2460
     aaaattctgc cccctgacat caacagcggt ttgtaccatt tccatgtaaa cgatgatggc      2520
     gaaattgttt atggtattgg tgccattaaa ggtgtaggtg aggggccgat agaagccatt      2580
     ctggaggcgc gtaaagaggg gggctatttt aaagagttat ttgacctatg cgcccgtgtc      2640
     gataccaaaa agcttaacaa gcgtatttta gaaaaactga tcatgtccgg tgcatttgac      2700
     cgtttggggc cacaccgtgc agcattgatg agttctctcg gggatgcgct taaagccgca      2760
     gatcaacatg ctaaagccga agcaattggt caggtagata tgtttggtgt attagccgac      2820
     gcgcctgagc aggttgagca atcctatgcc aatgtgccgc catggcagga gcaggttgtt      2880
     ttagatggtg aacgggaaac gctggggctg tatttaactg gccatccgat cactcagtac      2940
     ctcaaggaaa tcgaacgcta tgccggtggg atgcgtttga aggatatgca tccgacggat      3000
     cggggcaaaa tgaccaccgc agtggggttg gtgatcgcgg caagggttat ggtcacaaaa      3060
     cgtggtaatc gcattggtat ttgtacgcta gatgaccgct ctggtcgtct ggaggtgatg      3120
     ttattcaccg atgcattgga aaaatatcag catttattgg aaaaagaccg tatcctgata      3180
     gccaccggac aggtcagctt tgatgacttt agtggtgggc ttaaaatgac cgcccgtgag      3240
     ttaatggaca tcagtgaagc tcgtgaaaaa tatgcaagtg ggcttgctat ctcgctgact      3300
     gacaggcaaa ttgatgacca gcttttgaac cgtctccgtc agtcgttgga accccatcga      3360
     gcggggacga tcccagtaca tctttattac caacgggaag atgctcgcgc ccggctgcgg      3420
     tttggagcca catggcgcgt gacgcccacc gatcgcttat taatcgattt gcgaacgttg      3480
     gtaggtaatg agcaagtgga actggaattt gactaa                                3516
//

If you have problems or comments...

PBIL Back to PBIL home page