(data stored in ACNUC9543 zone)

EMBL: CP000308.PE537

CP000308.PE537       Location/Qualifiers
FT   CDS_pept        622653..624035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12506"
FT                   /db_xref="GOA:A0A0E1NQS5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQS5"
FT                   /protein_id="ABG12506.1"
FT                   /translation="MNLVTSKPNVLLNPLFAQLGENRHVLVGFSGGLDSTVLLHLLVCL
FT                   RQQLIPELNIRAIHIHHGLNPQADSWVKHCMQQCDQWKIELKVVRVNIDPRQNGIEAAA
FT                   RTARYQAFSANLAAKEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLL
FT                   RPLLAFSREILENYAQAQQLQWIEDDSNQDDRFDRNFLRLNVLPILNQRWPHFAQATAR
FT                   SAGLCAEQEQLLDELLAENLQQLQGPDRSLSIDGLLQASMAKRAAILRRWLASLGAPMP
FT                   SQSQLQRLWLEVAMARQDAEPQLMIGTRQVRRFRQHLYLLMPLAEITTNYLPWATVKAA
FT                   PNSSIIPLLPEPLWLPADLGVLRFVSAGGQAVRPAAVGEEISVRFGLQGDIKIVGRHHS
FT                   RQSKKVWQELGIPPWQRERIPLLYFGEQLIAAAGVFVTQAGQANENEPCWHLDWDKPLR
FT                   LG"
     atgaacttag tcacctcgaa acccaatgtg ttacttaacc ctcttttcgc tcaactgggt        60
     gaaaaccgtc atgtgttggt ggggtttagt ggtgggttag attccacggt gttactgcat       120
     ttattggtct gtttacgtca acaacttatt cctgaactga acattcgcgc tattcatatt       180
     caccatggtt taaacccgca ggctgatagt tgggtaaaac attgtatgca gcaatgtgat       240
     caatggaaaa ttgagcttaa ggtggtgcga gttaatattg atcctcggca gaacgggata       300
     gaagcggcag ccagaacagc acgttaccaa gccttttccg ccaatttggc tgccaaagaa       360
     gtcttactga ccgcccagca tttggacgat caatgtgaga ccttcctgtt ggcacttaag       420
     cgtggtagcg ggccggcggg tctctctgcg atggcggcta aaatgccctt tgcccacagc       480
     caactgttgc ggccactact cgctttttct cgagagatat tagagaacta tgcacaggca       540
     cagcaattac aatggattga agatgatagc aatcaagatg atcgttttga tcgcaatttc       600
     ttacggctaa atgttctgcc gatacttaat caacgttggc cacattttgc tcaggccacg       660
     gcacgtagtg cggggctatg tgctgagcag gagcagttat tggatgaact gttggctgaa       720
     aacttgcagc agttacaggg acctgacaga tcactctcta ttgatggact attacaggca       780
     tcaatggcga aacgggcggc tatattgcgc cgctggttgg cgagtcttgg tgcaccaatg       840
     ccatcacaaa gccaattgca gcgcctgtgg ctggaggtcg ccatggcacg gcaagatgcg       900
     gagcctcaat taatgattgg cacccgtcag gtacgccgtt ttcgtcaaca tctgtattta       960
     ttaatgccct tggctgaaat aacaacaaat tacttacctt gggcaaccgt taaggccgcc      1020
     ccaaattcgt cgataatacc tttattaccc gagccattat ggctacctgc cgatttaggc      1080
     gtactgaggt ttgtctcagc gggtgggcaa gcggtccgtc ctgccgccgt tggcgaggag      1140
     ataagtgtac gttttggttt acagggagat atcaaaattg ttgggcggca tcactcgcgt      1200
     caaagtaaaa aagtatggca agagctgggt attcccccat ggcagcggga acgtattccg      1260
     ctgttatatt tcggtgaaca attaattgca gccgcggggg tattcgttac ccaagcgggg      1320
     caggcgaatg aaaatgagcc atgctggcac ttagattggg ataaaccact tagattggga      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page