(data stored in ACNUC9543 zone)

EMBL: CP000308.PE539

CP000308.PE539       Location/Qualifiers
FT   CDS_pept        complement(624854..625114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12508"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSG3"
FT                   /protein_id="ABG12508.1"
FT                   /translation="MSMSEEYQPINCDDYDNLELACQHHLILTLKLRGGEIVEGKASDL
FT                   LLRKKVEYLIVEQEGTMRELRLDHIASFSHPEIGTVVVSAS"
     atgtcgatga gtgaagagta tcaacccatc aattgtgatg actacgataa tctggaactc        60
     gcctgccaac atcacctgat actgacgttg aagttgagag gcggtgagat cgtagaaggc       120
     aaagccagcg atctgctgct gagaaaaaag gtcgagtacc tgattgtcga gcaagaaggg       180
     acaatgcgcg aattgcgtct ggaccatatc gccagcttca gtcaccccga aattggaacg       240
     gtcgtagtga gcgcatcata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page