(data stored in ACNUC9543 zone)

EMBL: CP000308.PE54

CP000308.PE54        Location/Qualifiers
FT   CDS_pept        70870..71163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12023"
FT                   /db_xref="GOA:A0A0E1NW44"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW44"
FT                   /protein_id="ABG12023.1"
FT                   /translation="MNLNNKQKQHLKSLAHPLKPVVMLGNNGLTEGVLAEIEQTLAHHE
FT                   LIKVKITAEERETKALIADAIVRETGAVNVQMIGNILVLYRPAKERKIILPR"
     atgaatctga ataacaaaca aaaacagcac ctgaaaagct tggcccatcc gttaaaacca        60
     gtagtcatgc tgggcaataa cggcttaacc gaaggggtgc tggctgaaat cgaacaaacg       120
     ctagcacatc atgaacttat taaggtgaaa atcactgctg aagagcgtga aaccaaagcc       180
     ctaattgctg acgctattgt gcgtgagacc ggtgccgtta acgtccaaat gatcggtaat       240
     attttagtac tctatcgccc ggcgaaagaa cgcaaaatta ttttaccgcg ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page