(data stored in ACNUC9543 zone)

EMBL: CP000308.PE541

CP000308.PE541       Location/Qualifiers
FT   CDS_pept        625543..626091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12510"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ8"
FT                   /protein_id="ABG12510.1"
FT                   /translation="MALKATIHKAAINIADMDRNFFQDINLTIAQHPSETDQRMMLRLL
FT                   AWICHADERLLFTKGLSADDEPEVWRHNDHNGIELWIELGLPEEKRLRKACNQSKQVVL
FT                   YAYSERAAKVWWPQVQEKLAGHRNLRVRFLDDEQMAKLAALSNRNMSLQATLQEGTIWL
FT                   SDVQNNLEISFAEWQNYGQ"
     atggcactaa aagcaactat ccataaagcc gctattaaca ttgcagatat ggaccgtaat        60
     tttttccagg atattaacct gacgatagcg caacatccct cggaaacgga tcaacgtatg       120
     atgctgcgtt tactggcatg gatttgccat gctgatgagc gcttgctgtt taccaaagga       180
     ctcagtgctg atgatgaacc cgaagtttgg cgccataatg accacaacgg cattgagctg       240
     tggattgaat tggggctacc tgaagagaaa cggttgcgca aagcctgtaa tcaatcaaaa       300
     caagtcgttc tgtatgcata cagtgagcgt gcggccaaag tctggtggcc acaagttcag       360
     gagaaactcg ctgggcatcg taacttaaga gtgcgttttc ttgatgacga acaaatggcg       420
     aagttggctg cgctgtctaa ccgcaatatg tcattacagg cgacactgca agaagggact       480
     atctggctat cagatgtaca gaataatctg gaaattagtt ttgccgaatg gcaaaactac       540
     gggcaataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page