(data stored in ACNUC9543 zone)

EMBL: CP000308.PE545

CP000308.PE545       Location/Qualifiers
FT   CDS_pept        complement(629234..629941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12514"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUK8"
FT                   /protein_id="ABG12514.1"
FT                   /translation="MSTFSFNQIGVIRSPYKEKFAVPRQPGLVEDGGGELQLLAPYNQP
FT                   ESVRGLSDFSHLWVIFVFHQTMEGSWRPTVRPPRLGGNTRMGVFATRSTFRPNPIGMSL
FT                   IELKGVRCQNGEVILALGSLDLVDGTPVIDIKPYLPFAESQPQARAGFAQSAPDTEMQV
FT                   CFSPAAEQQLAHHQQRYPHLRRFISQVLAQDPRPAYRKDDNESREYAVLLLEFNVRWRV
FT                   IGQQTEVLSLDPR"
     atgagtacat tctcttttaa tcagatcggc gtgatccgtt caccgtataa agaaaagttt        60
     gcggtaccac ggcaacccgg tttggttgag gatggtggtg gcgaattaca gttgctggca       120
     ccttacaacc aaccagaaag cgtacgcggc ttatctgact tcagccattt atgggtgata       180
     ttcgttttcc atcagacgat ggagggtagc tggcgtccaa ctgttcgccc tccccgtctg       240
     gggggaaata cacgaatggg cgtatttgcg acccgttcaa cttttcgtcc aaacccgata       300
     ggcatgtcgc tgattgagtt gaaaggcgtt cgttgccaaa acggtgaggt gattctggca       360
     ttgggcagcc tggatttagt tgatggcacg cctgttattg atattaaacc ttatctgcct       420
     ttcgctgaga gccaacctca ggcgcgcgct ggttttgcgc aatctgcacc agatacagag       480
     atgcaagttt gcttttctcc cgccgccgag caacagttag ctcaccacca gcagcgttat       540
     ccacatcttc gccgttttat cagccaagtt ttagcacaag atccacgccc agcttaccgt       600
     aaagacgata atgaaagccg tgaatatgcc gttttattac tggaatttaa tgtgcgctgg       660
     cgggttattg gccagcaaac agaagtgtta tcactcgacc cacgctaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page