(data stored in ACNUC9543 zone)

EMBL: CP000308.PE554

CP000308.PE554       Location/Qualifiers
FT   CDS_pept        641596..642357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12523"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX6"
FT                   /protein_id="ABG12523.1"
FT                   /translation="MRYVAGQPVEQIFPGAAKQLDKGLPLGEPLPTAELLRVVVWNIFK
FT                   QQRAGWLPVLKELGRDTQLMLLQEAQTTPELVRFATASYQAADQVPAFSLPQHPSGVMT
FT                   LAAAHPVYCCPLREREPLLRLSKSALVTVYPIHDGRLLMVVNIHAVNFSLGVDVYSKQL
FT                   DPIGDQIASHRGPVILAGDFNAWSRQRINALQHFAQDAGLQEVEFRVDHRSRAFGRPLD
FT                   FIFYRGLTVIDASVLVTRASDHNPLIVEFQP"
     atgcggtatg ttgcaggaca accggttgaa cagatcttcc ctggcgccgc taagcaactc        60
     gataaaggct tgccgttagg cgaaccatta cctacagctg aacttttacg agtggtagtg       120
     tggaatatct ttaagcagca gcgggctgga tggctacctg tacttaagga actcgggcgt       180
     gatactcaac tgatgttact gcaagaagca caaactacac ctgagttggt gaggtttgcg       240
     actgccagct atcaggccgc agatcaggta cctgcttttt cattgcccca gcacccttct       300
     ggtgtgatga cgctggctgc ggctcatcca gtatattgtt gccctttgcg tgagcgtgag       360
     ccgctactgc gcttgtctaa atcggcttta gttactgtct atcctattca tgatggtcgc       420
     ttgttaatgg tggtgaatat tcatgcggta aacttcagtc ttggtgtcga tgtttacagc       480
     aaacagctcg atccgattgg tgatcaaatt gcttcacatc gtggcccagt tattcttgcg       540
     ggtgatttta atgcctggag ccgccaacgt attaatgcct tgcagcactt tgcacaggac       600
     gctggtttac aagaggttga atttcgcgtc gatcaccgca gtcgtgcgtt cggccggcct       660
     ctggacttta ttttttatcg cggccttacc gttattgatg cttcagtttt agtgaccaga       720
     gcctccgatc acaacccact cattgtcgaa ttccaaccat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page