(data stored in ACNUC9543 zone)

EMBL: CP000308.PE557

CP000308.PE557       Location/Qualifiers
FT   CDS_pept        644659..645378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12526"
FT                   /db_xref="GOA:A0A0E1NPY2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY2"
FT                   /protein_id="ABG12526.1"
FT                   /translation="MKPAQIRQNIETPASWAELPWGEYYRAALEQQLQPWWPKFFGFHL
FT                   LKVGHLSAEIASDKCAIAHQVNVGEWGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAA
FT                   NPHRILREVDRVLIDDGWLVISGFNPFSLLGLGKLVPVLRQRQPYISRMFTQMRLLDWL
FT                   SLLNYEVVHLSCFHVLPFNKNGGHFISTHLPALGCVNLIIARKRTVPLTFNPMKFGVRK
FT                   PWFSRAVGATKSYRDQP"
     atgaaaccag cgcaaatacg ccaaaatatt gagacacctg catcttgggc tgaattacct        60
     tggggggaat attaccgcgc ggcgcttgaa cagcaactgc aaccctggtg gccaaaattt       120
     tttggttttc acttgctgaa ggttggtcat ttaagtgctg aaattgccag cgataaatgt       180
     gcgattgctc atcaggttaa tgtcggggag tggggcaaaa atatgcaggt gctcgccagt       240
     ccttatcagt taccctttgc tgaaaaatcg gtagatgctt gcttactttc ccatactttg       300
     gcttatgccg ctaacccgca ccgtattcta cgtgaagtcg atagggtatt aattgatgat       360
     ggttggctgg ttatcagcgg tttcaatcca ttcagtttgt taggcttggg aaaattggtg       420
     ccggtattac gtcagcgaca gccatacatc agccggatgt ttactcaaat gcgtttgctg       480
     gattggctga gtttgctgaa ttatgaagta gtacatttat cgtgctttca cgttttgccc       540
     ttcaataaga acggtgggca ctttatcagt acccacctgc ctgcgttggg atgtgtcaat       600
     ctaattattg cccggaaacg cacggtgcca ttgacgttca atccgatgaa gttcggcgta       660
     cgtaaacctt ggtttagccg ggccgttggt gcaacaaaaa gttaccggga tcaaccctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page