(data stored in ACNUC9543 zone)

EMBL: CP000308.PE565

CP000308.PE565       Location/Qualifiers
FT   CDS_pept        651490..651807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0566"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12534"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT35"
FT                   /protein_id="ABG12534.1"
FT                   /translation="MKTIKHYLTPEGRDLYMEYLKSLRDSIAKAKISSRVNRIASGNFG
FT                   DHKPCREGVWELRIDQGPGYRVYYSLVDGEVVLLLLGGDKRSQNADIDQAIVCLKDYLT
FT                   R"
     atgaaaacga tcaaacacta tctgactccc gagggacggg atttatacat ggagtatttg        60
     aagagtctcc gtgattcgat cgctaaggca aaaatatcat caagagttaa ccggatcgct       120
     tcggggaact ttggggatca taagccttgc cgtgaaggtg tctgggaact tcgtatagac       180
     caggggccag gttacagggt ttattacagc cttgttgacg gtgaagtcgt gttgttgctt       240
     ttgggcggtg ataagcgctc gcagaatgcc gacatcgatc aggctattgt gtgtcttaaa       300
     gattatttaa cgaggtaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page