(data stored in ACNUC9543 zone)

EMBL: CP000308.PE566

CP000308.PE566       Location/Qualifiers
FT   CDS_pept        651813..652127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0567"
FT                   /product="putative DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12535"
FT                   /db_xref="GOA:A0A0E1NUC2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUC2"
FT                   /protein_id="ABG12535.1"
FT                   /translation="MAKARLHDDAMVQLLMEDPEFAQVYLHQALLDIDEEGGQEAFLMA
FT                   LRHVVEARGGMASVAKKAGVSRETLYRTLSPSGNPTLKTLLSVVSATGFQFSHLASITA
FT                   "
     atggccaaag cccgtttaca tgatgacgct atggttcagc ttcttatgga agaccctgaa        60
     tttgcgcaag tatatctgca tcaggctctt ctagatattg atgaggaagg agggcaagaa       120
     gcctttctga tggccctacg tcatgtagtt gaggcccgag gagggatggc aagtgtggct       180
     aaaaaagcgg gtgtatcgag agaaacactg taccggacgt tatcaccttc aggtaatcca       240
     acactaaaaa cactgcttag tgtggtatct gcaacgggat ttcagttttc acatcttgca       300
     tcgattaccg catga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page