(data stored in ACNUC9543 zone)

EMBL: CP000308.PE569

CP000308.PE569       Location/Qualifiers
FT   CDS_pept        complement(654513..655055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0570"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12538"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMK3"
FT                   /protein_id="ABG12538.1"
FT                   /translation="MIFYFFLAGALQYNPFAAAKSVAGISVPKIFLIPSLVIQTWSFIG
FT                   MACAHPSMVAQAGAPKGAPVSKKSGNANSVWATTQGISVSGGSHYNYFLEAAQWLLPFT
FT                   VCTRNTFVPIRGCAMHNSSPLTIEEIVDHCHALVLAMLEITDPTAKELLLFILAERLDL
FT                   LQLMLDEVPDAEEANHE"
     atgatttttt atttttttct ggcgggcgct ttgcagtata atcctttcgc tgcggcaaaa        60
     tccgtagccg gaattagcgt tccgaaaatc ttcttgatac ctagcctcgt cattcagaca       120
     tggtctttta taggtatggc ttgcgcacac ccgtcaatgg tggcccaggc gggggctccg       180
     aaaggagcgc cggtttccaa gaagtccggt aacgctaact ccgtctgggc taccacccaa       240
     gggattagcg tctcaggtgg tagtcattac aactacttct tggaggcggc ccaatggcta       300
     ctacccttca ctgtctgtac ccgcaatacg ttcgtaccca tccgggggtg tgctatgcat       360
     aactcttccc cgctcacgat tgaagaaatt gttgatcact gccacgcact ggtattggca       420
     atgctcgaaa ttaccgatcc tacagcgaaa gaactgttgc tatttattct ggctgaacgg       480
     ctggatttgc tgcaactgat gctggatgaa gtgccggatg cagaggaggc taaccatgag       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page