(data stored in ACNUC9543 zone)

EMBL: CP000308.PE571

CP000308.PE571       Location/Qualifiers
FT   CDS_pept        complement(655248..656135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0572"
FT                   /product="putative DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12540"
FT                   /db_xref="GOA:A0A0E1NXD8"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXD8"
FT                   /protein_id="ABG12540.1"
FT                   /translation="MSRLSREMKMLAKQAGGSHKTVHDRIRIMDRFSRHLLALNIQVRD
FT                   VKHLKAKHIESYITDRFSQGIAIRSLHNEMAALRTVFRFAGRDKIVLSERLTNKALGLG
FT                   GASRAGSKFAIPEEVYQAALRTAQQQDKGLACALQLARLLGLRSQEAVQCANSLKTWQK
FT                   ELEQNRSKLTVVFGTKGGRSRETRILDPEAVKRAVKEAQQIAETRGGKLIDKPDLKTAM
FT                   NFWRSHTTRLGLTGHYSPHSLRYAWAQDAINYYLAAGFSRIEARALTSMDLGHGDGRGR
FT                   YVERVYTRKEANYV"
     atgagtcggt taagtcgtga gatgaaaatg ctggcaaaac aagctggcgg tagccataaa        60
     accgttcatg atcgtattcg gattatggac aggtttagcc gccatctgct ggcccttaat       120
     attcaggtgc gtgatgttaa acacctaaaa gcaaagcata ttgaaagtta tattactgac       180
     cgtttttcac aggggatcgc gatccgttct cttcataacg aaatggcggc attgcgcacc       240
     gttttcagat tcgctggtcg ggataaaatc gtcttatcag aacgattaac caacaaagca       300
     ttggggttag gtggagccag ccgcgccggt agcaaattcg ctatccctga ggaggtgtat       360
     caagccgctc tgcgcaccgc ccaacagcaa gacaaaggac tcgcctgcgc ccttcagctt       420
     gcccgcctgc tggggctgcg ttcacaagag gcggtgcaat gcgccaactc gttgaaaaca       480
     tggcaaaagg agcttgagca gaaccggtct aaactaaccg tggtgtttgg caccaaggga       540
     ggccgctcac gcgaaacccg cattctggat cctgaagcag tcaaacgggc agtcaaagaa       600
     gcgcaacaga tcgccgaaac acgcggcggc aaacttattg ataaacctga cctgaaaacc       660
     gcgatgaatt tctggcgctc ccataccacc cgcttagggc tgaccggaca ttactccccc       720
     cacagcctgc gctatgcctg ggcgcaagac gctattaatt attacctcgc cgcaggattt       780
     agccgcattg aagccagagc gttaacgtca atggatctgg gtcatggtga tggccgtggc       840
     cgctatgttg aacgcgttta tacccgcaag gaggcgaact atgtctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page