(data stored in ACNUC9543 zone)

EMBL: CP000308.PE572

CP000308.PE572       Location/Qualifiers
FT   CDS_pept        complement(656157..656480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3G6"
FT                   /protein_id="ABG12541.1"
FT                   /translation="MLLVASLLRVKVTPQHKPASAFEISDFTQHVMHLTPLQYVRLTAF
FT                   YKIFEPIPRQANSLGDDLQKQEAAPSASPIPRNTSTAARSGAQVSFKADNLPFPMRQRN
FT                   AAS"
     gtgttgctcg tggcgtcact tttacgagtg aaagtgacgc cacagcacaa acctgcctca        60
     gcctttgaga taagcgactt cactcaacac gtcatgcatc tgacaccact tcaatacgtc       120
     aggctgaccg ctttttacaa gatatttgaa ccgataccga ggcaggccaa cagcctgggg       180
     gatgacctgc aaaagcagga ggctgcaccg agtgcatcac cgataccccg caatacctca       240
     actgctgccc gctctggcgc acaggtatcg ttcaaggcag ataacctgcc attccccatg       300
     cgccagagaa atgcagctag ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page