(data stored in ACNUC9543 zone)

EMBL: CP000308.PE575

CP000308.PE575       Location/Qualifiers
FT   CDS_pept        complement(659053..660141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12544"
FT                   /db_xref="InterPro:IPR025382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS3"
FT                   /protein_id="ABG12544.1"
FT                   /translation="MDSEDTSDNPLSEPQRESAGAQSYDRFEYQYHWALCKAFSSYKES
FT                   NDFAIFMEYHEDVVYANSIDKNKVKFTFNQIKANAKKTYTAKVLTKRENGTKPSLLGKL
FT                   CSSVSDKKYFEKVEKLDFITTSGFNLTKNNKLNLASYKLSSLSSDEASEIIKCLSDELA
FT                   NFGKFPQEIIHFTTSDIPLESYYEHTISRITDSVEEVYPQHLLRTKDIYRILMDSLRIR
FT                   GKNVFDYENWNDALTKKALTYKDIHTVVTKIVSKGNSDLNFEAIKYILDDLNLKGTIKA
FT                   KIIQKINSYSLTLLSPTLAIIKAQKEIQELLKKNSKKIEIEMSYELLERLIIDLSKDTI
FT                   GLFEDNISISSAIIYEMVEATN"
     atggatagtg aagacacatc tgacaatccc ttgtccgaac cgcaaagaga gtccgcaggg        60
     gcccagtcct atgatcgatt tgaataccaa tatcattggg ctctttgtaa agcattcagt       120
     tcatacaaag aaagcaatga ctttgcaatc ttcatggaat atcatgaaga tgttgtctat       180
     gcgaattcta tagataaaaa taaagttaaa tttactttca atcaaattaa agccaatgca       240
     aagaaaactt atactgcaaa agtattaacc aagcgagaga atggtacaaa accatctctt       300
     ttagggaagc tttgtagttc agttagcgac aaaaaatact ttgaaaaggt tgaaaaatta       360
     gattttataa ctacaagtgg attcaacctc actaaaaaca acaagttaaa cttggcttca       420
     tataaactgt ctagcttaag tagtgatgag gctagtgaaa ttataaaatg cctaagtgat       480
     gagctcgcta acttcggaaa gtttccgcaa gaaataatac acttcactac ctctgacatt       540
     cctctagaaa gctattatga gcatacaata tcaaggatca ctgatagcgt cgaagaagtg       600
     tatccacaac atctacttcg tacgaaagat atttatagaa tattaatgga ctcattacgc       660
     atcagaggga agaacgtttt tgactatgaa aattggaatg atgctcttac taaaaaagca       720
     ctgacctata aagatatcca tacggtagta accaaaatag tctcaaaagg taattccgat       780
     ttaaattttg aagcaataaa atacatatta gatgatctaa atttaaaggg cacgattaag       840
     gcaaaaataa tacaaaaaat aaattcatat tcactaaccc tactctcacc gacccttgca       900
     attatcaaag cccaaaaaga aatacaagag ttacttaaaa agaactctaa aaaaattgaa       960
     attgaaatgt cttatgaatt gctcgaaagg ctaatcatag acttatcaaa agatactatt      1020
     ggtttgtttg aggataatat ttctatatca tctgcgatca tttacgaaat ggtagaggca      1080
     acaaactaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page