(data stored in ACNUC9543 zone)

EMBL: CP000308.PE580

CP000308.PE580       Location/Qualifiers
FT   CDS_pept        663806..664090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12549"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAH3"
FT                   /protein_id="ABG12549.1"
FT                   /translation="MPDIRVEVVYALSERQYLRTVSLVVGSTVEDAIKASGLLELRPDI
FT                   DLEKNKVGIYSRPVKLGDKLNDGDRVEIYRPLIADPKELRRQRAEQAKK"
     gtgcctgata ttcgcgttga ggttgtatat gccttatctg aacgccaata cttgcgcact        60
     gtatctttgg tggttggcag tactgttgag gatgcgatca aggcatcagg cttactggag       120
     ttacggccag acattgacct ggaaaaaaat aaagtgggta tctatagtcg cccggtaaaa       180
     ctcggtgaca aactcaatga tggtgatcgg gttgaaatat atcgcccatt aatagccgac       240
     cccaaagagc ttcgccggca gcgagctgag caggcaaaaa agtaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page