(data stored in ACNUC9543 zone)

EMBL: CP000308.PE581

CP000308.PE581       Location/Qualifiers
FT   CDS_pept        complement(664240..664581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12550"
FT                   /db_xref="GOA:A0A0E1NXF8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF8"
FT                   /protein_id="ABG12550.1"
FT                   /translation="MRCKMLTAAAVMLAMLTAGCSTLEKVVYRPDINQGNYLSPIDASK
FT                   IHKGMTQQQVAYTLGTPMLQDPFGTQTWFYVFRQQPGHEKITQQTLTLTFDSSGVLTDI
FT                   KNEPALTGS"
     atgcgctgta aaatgctgac tgccgccgct gtgatgcttg caatgcttac tgcgggttgt        60
     tcaacgttgg agaaggtggt ctaccggcct gatattaatc agggtaacta tttatcacct       120
     attgatgcct ccaaaattca taaaggtatg acacagcaac aagtggcgta taccttaggc       180
     acgccgatgc tacaagatcc gtttggcact caaacctggt tctacgtttt ccgccaacaa       240
     cctggtcacg aaaaaataac gcaacaaacg ttaacgttga cctttgatag cagtggtgta       300
     ctgactgata tcaaaaatga gcccgcgtta accggaagct aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page