(data stored in ACNUC9543 zone)

EMBL: CP000308.PE586

CP000308.PE586       Location/Qualifiers
FT   CDS_pept        670124..670513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0587"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12555"
FT                   /db_xref="GOA:A0A0H2Y4P9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4P9"
FT                   /protein_id="ABG12555.1"
FT                   /translation="MGKTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL
FT                   WLLGLSVSSQEGFMQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLA
FT                   VGTRSAQVAMGLTLVLSVLAGVLVW"
     gtgggcaaaa ccgtgaaaaa acaaagacct gtcaatttgg atctgcaaac gattcgattt        60
     cctgttactg cgatagcgtc catcttacac cgagtctctg gcgtaattac cttcgtggct       120
     gtcggtatcc tcctctggct gttgggtttg tctgtttcct cacaagaagg attcatgcag       180
     gcagcaacca tcatgaatag tttttttgtt aaattcatct tttggggaat actcactgcg       240
     ctggcttatc acatttgcgg tggcatccgt cacttgttaa tggattttgg ctatctcgaa       300
     gagaatttag ccgtgggtac ccgttctgct caagtggcaa tgggattaac cctcgtgttg       360
     tcagttttgg ctggagtcct cgtatggtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page