(data stored in ACNUC9543 zone)

EMBL: CP000308.PE588

CP000308.PE588       Location/Qualifiers
FT   CDS_pept        670855..672621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0589"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12557"
FT                   /db_xref="GOA:A0A0E1NT12"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT12"
FT                   /protein_id="ABG12557.1"
FT                   /translation="MNLPIREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGL
FT                   PFSRLEDGSIYQRPFGGQSLNFGGGQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAFVGCTAINIETGEVVYFKARATILATGGAGRIYQSTTNAHINTGDG
FT                   VGMALRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHV
FT                   DPIKEPIPVIPTCHYMMGGIPTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGMHLQESLMEQGASRDASESDIEASLARMNRWNNTRSGEDPVE
FT                   IRKALQACMQNNFSVFREGDAMAKGLEELKTIRERLQNARLDDTSSEFNTQRIECLELD
FT                   NLMETAFSTAVSANFRTESRGAHSRFDFPDRDDVNWLCHSLYLPGTESMTRREVNMQPK
FT                   LREAFPPKVRSY"
     atgaatctgc caatcagaga gtttgatgca gttgttgtcg gtgcaggtgg tgccggtatg        60
     cgtgccgccc tgcaaatttc acaaatgggc ctgtcttgcg ccctgatatc taaagtcttc       120
     cctacccgtt cccataccgt atctgcgcag ggggggatta ccgttgcgct gggtaatacc       180
     catgaagata actgggaatg gcacatgtac gatacggtaa agggttccga ttatatcggc       240
     gatcaggatg ccatcgaata tatgtgtaaa accggtccgg aagcggttct ggaattggag       300
     cacatgggtt tacctttctc ccgtttagag gatgggagca tttatcagcg tccatttggg       360
     gggcagtcac tgaactttgg cggtgggcaa gcggcgcgta cagcggctgc agctgaccgc       420
     accggtcatg cgttgttaca caccctttat cagcaaaacc tgaaaaacca caccactatt       480
     ttctctgaat ggtatgcact ggatttggtg aagaatcagg acggcgcttt tgtcggttgt       540
     actgctatta atattgaaac cggcgaagtc gtctatttca aagcacgggc cacaatattg       600
     gcaactggcg gtgctgggcg tatttaccaa tcaacaacca atgcgcacat taataccggt       660
     gacggtgttg gtatggcctt gcgtgctgga gtcccggtgc aggacatgga aatgtggcag       720
     ttccacccga ccggtattgc cggtgcgggt gtattagtga ctgaaggctg ccgcggtgaa       780
     ggggggtatt tactgaataa acatggtgaa cgcttcatgg aacgttatgc cccgaacgcc       840
     aaagatttgg cgggtcgtga tgtagtggca cgttccatta tgattgaaat ccgtgaagga       900
     cgtggttgtg acggtccttg gggcccacat gccaaactga aattggatca cttaggtaaa       960
     gatgtgcttg aatcccgtct gccgggtatt cttgagctgt cgcgcacctt tgcacacgtt      1020
     gacccgatca aagaaccgat cccggttatc cctacttgcc attatatgat ggggggaatt      1080
     ccgactaaag tgacgggtca ggcgattacc gtaaatgaaa agggtgagga tgttgtgatc      1140
     cccggcttgt ttgctgtagg cgaaattgcc tgtgtttccg tccacggtgc gaaccgcttg      1200
     ggagggaact cattactgga cttagtggta tttggtcgtg ctgccggtat gcacctgcaa      1260
     gaatcattga tggagcaggg cgcaagccgc gatgccagtg agtcagatat cgaagcctct      1320
     ctggctcgca tgaatcgctg gaataatacc cgttcaggtg aagatccagt tgaaatccgt      1380
     aaagcattgc aagcctgtat gcagaacaat ttctccgtgt tccgcgaagg cgatgcgatg      1440
     gcaaaagggt tggaagagct gaaaactatc cgtgaacgtt tgcaaaatgc ccgtttggat      1500
     gacacttcca gtgaattcaa tactcagcgt attgagtgcc tggagctgga taacctgatg      1560
     gaaactgcgt tttcaaccgc tgtgtcggca aacttccgta ccgagagccg aggtgcccat      1620
     agccgcttcg atttcccgga tcgtgatgat gtgaactggc tgtgccattc actgtatttg      1680
     ccaggtactg agagcatgac ccgccgtgag gtaaacatgc aacctaagct acgcgaggca      1740
     ttcccgccga aagtgcgttc ttattga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page