(data stored in ACNUC9543 zone)

EMBL: CP000308.PE589

CP000308.PE589       Location/Qualifiers
FT   CDS_pept        672671..673387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0590"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12558"
FT                   /db_xref="GOA:A0A0E1NND6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NND6"
FT                   /protein_id="ABG12558.1"
FT                   /translation="MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEK
FT                   DPTLSFRRSCREGVCGSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLV
FT                   VDMGQFYTQYEKIKPYLLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFVGPAGLLAAYRFLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TKAIGHIKSMLLQRSA"
     atgaagctcg agttttcaat ttatcgctat aacccagatg tcgataacgc gccgcatatg        60
     caagattaca cgctggatgc ggaagaaggt cgggatatga tgttgctgga tgcacttatc       120
     cagttgaaag aaaaagatcc gacgttgtca ttccgtcgct catgtcgcga aggtgtgtgt       180
     ggttctgatg gtctgaatat gaatggcaaa aatggtttgg cctgtattac gccaatctca       240
     gctttgcaaa aaggcaataa aaagatagtg atccgccctc tgccggggtt accggtggtg       300
     cgagatttag tcgtcgatat ggggcagttt tatactcagt atgagaaaat aaaaccttac       360
     ctgttgaatg acggcaagaa tccaccagca cgtgagcacc tacagtcgcc ggaacaacgg       420
     gcaaaactgg atggtttgta tgaatgcata ttgtgcgctt gctgctcaac gtcttgtccg       480
     tcattctggt ggaatccaga caagtttgtt ggcccggctg ggttactggc tgcctatcgt       540
     ttcctgatag atagccgtga taccgaaacg gcctcacgtt tggatgacct ggacgatgct       600
     ttcagtgttt tccgctgcca tagcattatg aattgtgtca gtgtttgtcc taaaggtctt       660
     aatcctacca aagcaatcgg gcatattaag tctatgctgt tacaacgtag cgcatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page