(data stored in ACNUC9543 zone)

EMBL: CP000308.PE592

CP000308.PE592       Location/Qualifiers
FT   CDS_pept        677916..679082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0593"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12561"
FT                   /db_xref="GOA:Q1CAG1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAG1"
FT                   /protein_id="ABG12561.1"
FT                   /translation="MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDI
FT                   DKELYLGAVIDRSSRRVVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGREL
FT                   AFKLGLTGKQVGQFTKIFMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNA
FT                   LFRQPELREMRDPSQEDAREAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAATSLTDAAQQVVAAVGAK"
     atgaatttac acgaatatca ggcaaaacaa ctgtttgctc ggtatggcat gccagctcca        60
     actggctacg cctgtaccac tccgcgtgaa gcagaagaag ccgcatctaa aattggtgca       120
     ggcccgtggg tggttaaatg tcaggttcat gcgggcggcc gcggtaaagc ggggggcgta       180
     aaactggtta acagcaaaga agatattcgt gctttcgctg aacagtggct aggtaaaaaa       240
     ctggtcactt accaaacaga tgccaacgga cagccggtgc atcagatctt ggttgaagca       300
     gccacggata ttgataaaga actgtatctg ggggcggtta tcgatcgcag ctctcgccgt       360
     gtggtcttta tggcatccac tgaaggtggt gttgaaattg aaaaagtcgc cgaagagaca       420
     cctgaactga tccataaaat cgcattagat ccattgaccg gaccacagcc ttaccaaggg       480
     cgtgagctgg catttaaatt gggcttgacc ggtaaacaag tcggtcagtt caccaagatc       540
     tttatggggc tggcaacact gttcctggaa cgtgacctgg cgatggtaga gattaacccg       600
     ttggtggtca ctaagcaggg cgatctgatt tgtctggatg gtaagctcgg tgccgatggc       660
     aatgccttgt tccgtcagcc ggaactgcgt gaaatgcgcg atccaagcca agaagatgct       720
     cgcgaagcac atgctgccca gtgggaactg aactatgtgg cgttagatgg caacatcggt       780
     tgcatggtaa acggtgccgg tttggcgatg ggaaccatgg acatcgtgaa acttcatggt       840
     ggcgaacccg ctaacttcct tgatgtgggc ggtggtgcaa caaaagagcg cgtgaccgaa       900
     gcgttcaaaa tcattctgtc tgacgataaa gtgaaagcgg tttttgttaa tatcttcggc       960
     ggtatcgtgc gttgtgacct cattgctgac ggcatcattg gtgcagttga agaagtgggc      1020
     gttaacgtac ccgttgttgt tcgtctcgaa ggtaataatg cagagctggg tgccaagaaa      1080
     ctggcagaca gcggtttgaa tatcattgct gcgaccagcc tgacagatgc ggctcagcaa      1140
     gttgtagcgg cagtgggggc taaataa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page