(data stored in ACNUC9543 zone)

EMBL: CP000308.PE595

CP000308.PE595       Location/Qualifiers
FT   CDS_pept        682304..683443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0596"
FT                   /product="cytochrome D ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12564"
FT                   /db_xref="GOA:A0A0E1NPX6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPX6"
FT                   /protein_id="ABG12564.1"
FT                   /translation="MFDYEVLRFIWWLLIGVLLIGFAVTDGFDMGVGILLRIIGKNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYIAMILVLAALFFRPVGF
FT                   DYRSKLEDSRWRNMWDWGIFIGSFVPAVVFGVAFGNLLQGVPFHMNEYMRLFYTGNFFQ
FT                   LLNPFGLLAGIVSLTMLVTQGATYLQMRTRGELHLRSRKAAQISALVMSVAFLLAGIWL
FT                   VKGIDGFVITSVLDTAAESNPMRKEVAHQAGAWLINFNKYPILWALPALGVILPLFTIL
FT                   LSRFEKGAWAFLFSSLTIACVILTAGVTMFPFVMPSSTMPNVSLTMWDATSSLLTLKVM
FT                   TIVAIIFVPIILLYTSWCYYKMFGRIDKEFIENNKHSLY"
     atgtttgatt atgaagtatt acgatttatc tggtggctgc tgatcggtgt gctgctgatt        60
     ggtttcgcag tcaccgatgg tttcgatatg ggtgtgggta tcctgctacg tatcatcggt       120
     aaaaatgata cagagcgccg tatcatgatt aactcgattg ctcctcactg ggatggtaat       180
     caggtttggt taatcacggc aggtggggca ctgtttgcgg cctggccaat ggtctatgcc       240
     gctgcatttt ccggcttcta tatcgcgatg attctggtgc tggcagcctt gttcttccgc       300
     ccggtcggtt ttgactaccg ttctaagctg gaggatagcc gctggcgtaa catgtgggac       360
     tggggcatct ttatcggtag ctttgtgccg gcagtcgtct ttggtgtggc gtttggtaac       420
     ttgctgcaag gcgtaccttt ccacatgaat gagtatatgc gcctgttcta caccggtaac       480
     ttcttccagc tactgaaccc gtttggtttg ttggccggta ttgtcagctt gaccatgttg       540
     gtgacgcaag gcgcgactta cctgcaaatg cgtacgcgtg gtgaactgca ccttcgttcc       600
     cgtaaggccg ctcagatctc ggctctggta atgagtgttg ccttcttgct cgcgggtatc       660
     tggttagtta aaggtattga cggctttgtt atcacttcag tattggatac agcagctgaa       720
     tctaacccaa tgcgcaaaga agtggctcat caggccggtg catggttgat taacttcaac       780
     aagtatccaa tcctgtgggc tttacctgca cttggcgtga ttttgccact gttcaccatt       840
     ttgttgtcac gctttgaaaa aggggcatgg gccttcttgt tctcatcact gacgattgct       900
     tgtgtgatct tgactgctgg cgtaaccatg ttcccgttcg ttatgccatc aagcacgatg       960
     ccaaatgtca gtctgaccat gtgggatgcg acatctagcc tgttaacgct gaaagtgatg      1020
     acgattgttg cgataatctt tgtgcctatc atcctgcttt acaccagttg gtgttactac      1080
     aagatgttcg ggcgcattga taaagaattt atcgaaaaca acaagcattc actgtactaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page