(data stored in ACNUC9543 zone)

EMBL: CP000308.PE6

CP000308.PE6         Location/Qualifiers
FT   CDS_pept        5552..6574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0006"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11975"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG11975.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
     atggtcactt ttgagacagt tatggaaatt aaaatcctgc acaagcaggg aatgagtagc        60
     cgggcgattg ccagagaact ggggatctcc cgcaataccg ttaaacgtta tttgcaggca       120
     aaatctgagc cgccaaaata tacgccgcga cctgctgttg cttcactcct ggatgaatac       180
     cgggattata ttcgtcaacg catcgccgat gctcatcctt acaaaatccc ggcaacggta       240
     atcgctcgcg agatcagaga ccagggatat cgtggcggaa tgaccattct cagggcattc       300
     attcgttctc tctcggttcc tcaggagcag gagcctgccg ttcggttcga aactgaaccc       360
     ggacgacaga tgcaggttga ctggggcact atgcgtaatg gtcgctcacc gcttcacgtg       420
     ttcgttgctg ttctcggata cagccgaatg ctgtacatcg aattcactga caatatgcgt       480
     tatgacacgc tggagacctg ccatcgtaat gcgttccgct tctttggtgg tgtgccgcgc       540
     gaagtgttgt atgacaatat gaaaactgtg gttctgcaac gtgacgcata tcagaccggt       600
     cagcaccggt tccatccttc gctgtggcag ttcggcaagg agatgggctt ctctccccga       660
     ctgtgtcgcc ccttcagggc acagactaaa ggtaaggtgg aacggatggt gcagtacacc       720
     cgtaacagtt tttacatccc actaatgact cgcctgcgcc cgatggggat cactgtcgat       780
     gttgaaacag ccaaccgcca cggtctgcgc tggctgcacg atgtcgctaa ccaacgaaag       840
     catgaaacaa tccaggcccg tccctgcgat cgctggctcg aagagcagca gtccatgctg       900
     gcactgcctc cggagaaaaa agagtatgac gtgcatcttg atgaaaatct ggtgaacttc       960
     gacaaacacc ccctgcatca tccactctcc atctacgact cattctgcag aggagtggcg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page