(data stored in ACNUC9543 zone)

EMBL: CP000308.PE61

CP000308.PE61        Location/Qualifiers
FT   CDS_pept        complement(77547..77804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0061"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12030"
FT                   /db_xref="GOA:Q1CBZ2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ2"
FT                   /protein_id="ABG12030.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTKF
FT                   HAGINVGCGKDHTLFALADGKVKFEVKGPKNRKFISIEAE"
     atggcacata aaaaggctgg tggctcgact cgtaacggtc gtgactccga aagcaaacgt        60
     ctgggcgtaa aacgttttgg cggcgaagca gttctggcag gcagcatcat cgttcgtcag       120
     cgtggcacca aattccatgc aggcatcaat gtaggttgcg gcaaagacca tactctgttt       180
     gctttggctg acggtaaagt caagttcgaa gttaaaggcc cgaaaaaccg taaatttatc       240
     agcatcgaag ctgaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page