(data stored in ACNUC9543 zone)

EMBL: CP000308.PE619

CP000308.PE619       Location/Qualifiers
FT   CDS_pept        707084..707569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12588"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUU0"
FT                   /protein_id="ABG12588.1"
FT                   /translation="MDSLIVPDLALLRRWLDQLGISFFECDSCQALHLPHMQNFEGVFD
FT                   AKIDLVDNIILFSALAEVRPTALIPLVADLSQINASSLTVKAFIDIQDDNLPKLIVCQS
FT                   LVVEVGVTIEQFGYFMQQCEEQISMIIMEARANDLLFIGNNDEEEAPLTATSYPIIH"
     atggattcac tcatcgtccc tgatttagcc ttattacggc gttggctgga tcagctcggt        60
     atttcctttt ttgagtgtga ctcctgtcag gcgctccatt tgccgcacat gcaaaatttt       120
     gagggtgtgt ttgatgccaa aattgatctg gttgataaca ttatcttgtt ttcggcactg       180
     gccgaagtta ggccaaccgc gttgatcccc ttggtcgctg accttagcca aattaatgcc       240
     agctcactga cagtcaaagc gtttatcgat attcaggatg acaatctacc aaaactgatt       300
     gtctgccagt ctttggtggt ggaagttggc gtcacaattg agcaatttgg ctacttcatg       360
     cagcagtgtg aagagcaaat ctcgatgatt attatggaag cacgggccaa tgacttgttg       420
     tttattggca acaatgacga agaggaagca ccgttaaccg ccacctctta ccccatcatt       480
     cattaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page