(data stored in ACNUC9543 zone)

EMBL: CP000308.PE62

CP000308.PE62        Location/Qualifiers
FT   CDS_pept        complement(77824..78135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0062"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12031"
FT                   /db_xref="GOA:Q1CBZ1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ1"
FT                   /protein_id="ABG12031.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMIANGE
FT                   EINIGAPLVDGGKIKAEIIAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
     atgtacgcgg ttttccaaag tggtggtaaa caacaccgag taagcgaagg tcagaccatt        60
     cgcttggaaa agctggacat cgcaactggt gaaacgattg agtttgacca agttctgatg       120
     attgctaacg gtgaagaaat caatatcggc gctcctttag tcgatggcgg caagatcaaa       180
     gctgaaatta ttgctcatgg tcgcggcgag aagattaaga ttgttaaatt ccgtcgtcgt       240
     aagcattacc gtaagcagca aggtcatcgt cagtggttca ctgatgttaa aatcaccggc       300
     atcagcgctt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page