(data stored in ACNUC9543 zone)

EMBL: CP000308.PE621

CP000308.PE621       Location/Qualifiers
FT   CDS_pept        709367..710500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0622"
FT                   /product="putrescine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12590"
FT                   /db_xref="GOA:A0A0E1NVW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVW8"
FT                   /protein_id="ABG12590.1"
FT                   /translation="MNDVIPRPQPKSQKVFTPLLEIRNLTKSFDGQAAVDDVNLTIYKG
FT                   EIFALLGASGCGKSTLLRMLAGFEQPTQGQIVLDGQDLSHVPPYRRPINMMFQSYALFP
FT                   HMTVEQNIAFGLKQDKLPSNEIKSRVAEMLTLVHMQEFAKRKPHQLSGGQRQRVALARS
FT                   LAKRPKLLLLDEPMGALDKKLRDRMQLEVLDILERVGATCVMVTHDQEEAMTMAGRIAI
FT                   MNRGKFVQIGEPEEIYEHPNSRFSAEFIGSVNVFEGVLKERLDDALVIDSPGLRHPLKV
FT                   DSDASVVDGVPVLVALRPEKVMLCDQVPKDGCNFAVGEVVHIAYLGDLSIYHVKLHSGQ
FT                   MLSAQLQNGHRYRKGMPTWGDEVQLCWDADSCVVLGS"
     gtgaatgatg ttattccccg cccacagcca aaatcccaga aggtgtttac ccctttactg        60
     gaaatccgta acttaaccaa gtcattcgac ggtcaggcgg ctgtggatga tgtcaatctg       120
     accatttata aaggtgagat ttttgcgcta ttgggggcat caggttgtgg taaatctacc       180
     ctgttacgga tgctggccgg ttttgaacag ccaacgcaag gccagatagt ccttgatggg       240
     caggatttat cccatgttcc accgtatcga cgccctatca atatgatgtt ccagtcttac       300
     gcgctattcc cgcacatgac cgtggagcaa aacatcgcat tcggcttgaa gcaggataag       360
     ctgccgtcta atgaaattaa aagccgggtc gccgagatgc tgacactggt ccatatgcaa       420
     gagtttgcta aacgtaaacc gcatcaatta tccggtggtc agcgccagcg tgtggcattg       480
     gcacgtagct tggctaaacg gccaaaactg ctgcttttgg atgagccaat gggggcgctg       540
     gataaaaaac tacgcgaccg tatgcaactg gaagtgttgg atattttgga gcgggtgggc       600
     gcaacctgtg tgatggtcac ccatgaccaa gaagaagcga tgaccatggc cgggcgcatt       660
     gccattatga accggggcaa gtttgtgcag attggtgagc cagaagagat ttatgagcat       720
     ccgaacagca gattcagcgc tgagtttatc ggctcagtga atgtgttcga aggcgtgcta       780
     aaagagcgtt tagatgacgc gttggtgatt gatagccctg gcctgcgcca tccgctaaaa       840
     gtggattccg atgcctcggt cgttgacgga gtgcctgtgc tggtcgccct acgcccggaa       900
     aaagtgatgt tatgtgatca ggtccccaaa gatggctgca attttgctgt aggcgaagtg       960
     gtacacattg cctatctggg cgatttatcc atttatcacg tgaaattaca cagtggtcag      1020
     atgctaagtg cgcagttaca gaatggtcat cgctaccgta aaggcatgcc aacgtggggt      1080
     gatgaagtgc aactctgttg ggatgctgac agttgcgtgg ttttagggag ctaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page