(data stored in ACNUC9543 zone)

EMBL: CP000308.PE622

CP000308.PE622       Location/Qualifiers
FT   CDS_pept        710525..711490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0623"
FT                   /product="putrescine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12591"
FT                   /db_xref="GOA:A0A0E1NYC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYC6"
FT                   /protein_id="ABG12591.1"
FT                   /translation="MIPESTSGAAESPIRSVGPVRALIQRFQMAHGRKLVIAMPYLWLF
FT                   LLFMLPFLIVFKISLAEMVRAVPPYTDLTTWLDGKLDISLNLGNYLLLLDDPLYIDAYL
FT                   QSLQVAAVSTLCCLLIGYPLAWAIAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILK
FT                   NNGILNNFLIWTGIIDQPLVILHTNLAVYIGVVYSYLPFMVLPIYTALTRLDYSLVEAA
FT                   LDLGARPFKTFISVIIPLTKGGIVAGSMLVFIPAVGEFVIPELLGGPDSIMIGRILWQE
FT                   FFNNRDWPVASAVATVMLVLLIAPILWFHKHQNKDIGGAR"
     gtgataccag aatccacgag tggggccgca gaatccccga tccgctcagt tgggccggtc        60
     agggcgctga tacaacgctt ccaaatggcg catggccgta aactggtcat cgccatgcca       120
     tatttatggc tattcctctt atttatgctg cctttcctga tcgtgtttaa aatcagtttg       180
     gcggaaatgg tgcgggcggt tcccccttat accgatctca ccacttggct ggacggcaag       240
     ctggatatct cgctaaatct gggtaattac ctgctactgc tggatgatcc gttatatatc       300
     gatgcctatt tgcaatcgtt gcaagtggcg gcggtatcaa cgctgtgctg cctgcttatt       360
     ggctacccat tggcttgggc gattgctcac agtaaaccat cgacccgcaa catcttattg       420
     ctgttggtta tcttgccgtc atggacgtca tttctgatcc gggtttatgc ctggatgggg       480
     atcctaaaaa ataacggcat cttgaataac tttttaatat ggaccggaat tattgatcag       540
     ccgctagtca tcttacacac caatctggcc gtttatattg gcgtggtgta ttcctacctg       600
     ccatttatgg tgttgccgat ttataccgca ttaacgcgac tggattactc gctggtagaa       660
     gctgcgttgg atctcggggc caggccgttc aagacgttta tcagtgtgat tatcccgttg       720
     accaaaggcg gtattgtcgc tggctctatg ttggtattta tccctgcagt aggggagttt       780
     gtgatccccg agctccttgg tgggccggat agcatcatga ttggccgcat tttgtggcag       840
     gagtttttca ataatcgcga ctggccggtg gcctctgcgg tggcaaccgt gatgttagtg       900
     ctgctgattg ccccgatact ctggttccac aaacatcaaa ataaagatat tgggggcgcg       960
     agatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page