(data stored in ACNUC9543 zone)

EMBL: CP000308.PE623

CP000308.PE623       Location/Qualifiers
FT   CDS_pept        711487..712332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0624"
FT                   /product="putrescine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12592"
FT                   /db_xref="GOA:A0A0E1NPC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPC4"
FT                   /protein_id="ABG12592.1"
FT                   /translation="MNNLPEVRSVWRRVILTVGYTFLYAPMLMLVIYSFNSSKLVTVWA
FT                   GWSTRWYTQLFNDSAMISAVGLSLTIAAASATMAVVLGTIAAVVMVRFGRFRGSTGFAF
FT                   MLTAPLVMPDVITGLSLLLLFVAMGHAIGWPAERGMFTIWLAHVTFCTAYVTVVISSRL
FT                   RELDRSIEEAAMDLGATPLKVFFVITVPMIAPALISGWLLAFTLSLDDLVIASFVAGPG
FT                   ATTLPMLVFSSVRMGVNPEINALATLILLVVGVIGLFAWWIMSRAEKQRLRELRKAARS
FT                   "
     atgaataact taccggaggt gcgttctgtc tggcgtcggg tgatcctgac cgtcggttat        60
     accttcctgt atgccccaat gttgatgttg gtaatttatt cgtttaacag ctcgaagctg       120
     gtgacggtgt gggctgggtg gtcaacccgt tggtatacgc agttatttaa tgattcggcg       180
     atgatctctg ccgttgggct gagtctgacg attgccgccg cctctgccac tatggcggtg       240
     gtgttgggga cgattgccgc ggtggtcatg gtgcgctttg ggcgttttcg tgggtcaacc       300
     ggttttgctt ttatgctgac tgcaccgctg gttatgcctg atgtcatcac cggactgtca       360
     ctactgctgc tgtttgtggc gatggggcat gccattgggt ggcccgcaga acgtggcatg       420
     ttcaccatct ggctggccca tgtgactttc tgcacggcct atgtgacggt ggtcatcagt       480
     tcgcggttgc gcgaattgga ccgttctatt gaagaggcgg ccatggatct gggcgcgaca       540
     ccactgaagg tcttctttgt tattacggta ccgatgatcg cccctgcgct gatctctggt       600
     tggttgctgg cctttacctt atcccttgat gatctggtta ttgccagctt tgttgccggg       660
     ccgggggcca ccacgttacc gatgttggta ttctccagtg tgcgtatggg ggtgaatcca       720
     gagattaatg cgttagcgac acttatcctg ctggtggttg gggttatcgg tttatttgca       780
     tggtggataa tgtcgcgtgc ggaaaagcag agattgcgcg aattacgtaa agctgctcgt       840
     agctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page