(data stored in ACNUC9543 zone)

EMBL: CP000308.PE624

CP000308.PE624       Location/Qualifiers
FT   CDS_pept        712457..712921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0625"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12593"
FT                   /db_xref="InterPro:IPR019703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX17"
FT                   /protein_id="ABG12593.1"
FT                   /translation="MRPSFSSSAATPVPVVIGGTAIIATRIIGVLLLVAELGFSGVSDF
FT                   ISDSLQRWDTGLIFFASIVLLLLDMMCGVAVCHRRNWARWYYLICQLIIMIYLLMASLN
FT                   WLEPDIFRIEGDSGAEILHSLLLQKIPDVVIIGLLFFPWHRYFPQSKMSV"
     atgagaccgt ccttttcatc ctcagcagca acgcctgtcc ctgtcgtcat tggcggaacg        60
     gctatcattg cgacccgaat catcggcgta ttgctattag tggctgaact gggcttcagt       120
     ggtgttagcg attttatcag tgatagcttg caacgttggg ataccggctt gatttttttt       180
     gccagtattg tcttgctgtt gttggatatg atgtgtggtg ttgcggtgtg tcaccgccga       240
     aactgggcgc gctggtatta tctgatttgt cagttgatca tcatgattta cctgcttatg       300
     gcttcactga attggttgga gccagatatt ttccgcattg aaggcgatag cggcgctgaa       360
     atcttgcaca gtttgctttt gcaaaaaatc cccgacgtgg tgattatcgg gttgttattt       420
     ttcccctggc accgctattt cccccagtca aaaatgagtg tttaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page