(data stored in ACNUC9543 zone)

EMBL: CP000308.PE626

CP000308.PE626       Location/Qualifiers
FT   CDS_pept        complement(714262..714993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12595"
FT                   /db_xref="GOA:A0A0E1P0W2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0W2"
FT                   /protein_id="ABG12595.1"
FT                   /translation="MKKLLLATLLSGMAFSATAAETLRFAASATYPPFESMDANNEIVG
FT                   FDMDLAKALCKQMEANCTFTNQAFDSLIPALKFKRYDAVISGMDITPERSKQVAFTQPY
FT                   YANSAIVIAPKGKFSTFADLKGKKIGMENGTTHQKYLQDKHPEIQTVSYDSYQNAIIDL
FT                   KNGRIDGVFGDTAVVNEWLKTNPNLASVGEHVTDPQYFGTGLGIAVRPDNIALLTKLNK
FT                   AIDAVKADGTYQAINDKWFPQ"
     atgaaaaaat tactattggc aacgttatta agtggcatgg ctttcagcgc taccgccgca        60
     gagaccctcc gttttgcagc ctcagccacc tacccgccat ttgaatctat ggatgccaat       120
     aacgaaatcg ttggctttga tatggatctg gcaaaagcac tgtgtaaaca aatggaagcc       180
     aactgtactt tcactaatca ggcttttgat agcctgatcc cagcgcttaa attcaaacgt       240
     tatgatgccg ttatctctgg tatggatatc acgccagaac gcagcaagca ggtggcattc       300
     actcagcctt actacgctaa ctccgcgatt gttatcgccc cgaaaggtaa attcagcact       360
     tttgctgacc tgaaaggcaa aaagattggg atggagaatg gcactaccca tcagaaatat       420
     ttacaggata aacatcctga aattcagacc gtgtcttatg acagctacca gaatgccatc       480
     attgatctga aaaatggccg tattgatggt gtgtttggtg atactgcggt agtgaatgaa       540
     tggctgaaaa ccaatcctaa tttagcctct gtcggcgagc atgtgaccga cccacaatat       600
     ttcggcaccg gtttaggtat tgctgtgcgc ccggataaca tcgccctact gacaaaattg       660
     aataaagcca ttgatgcggt gaaagctgat ggtacttatc aagcgatcaa tgataagtgg       720
     ttccctcaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page