(data stored in ACNUC9543 zone)

EMBL: CP000308.PE630

CP000308.PE630       Location/Qualifiers
FT   CDS_pept        719294..720079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0631"
FT                   /product="putative transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12599"
FT                   /db_xref="GOA:A0A0E1NM00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM00"
FT                   /protein_id="ABG12599.1"
FT                   /translation="MTQLTLKHVGVTLHKRPLLTDISLTWPAAQVSGIIGPNGAGKSTL
FT                   LKAINHMVPITGQIEYQQCPLNTRVTRIAYVSQLNRSDSALTVFEMVLLGKVRQLSWRV
FT                   SPAQIDAVEQVLAECGISSLANQVFNSLSGGQRQLVMLAQAFIAQPQIILLDEPTSALD
FT                   IHHQLRVLQKIVDYSKRHQCTTLMVIHDLGLALRFCQTLTLIHRGNVACHGAAHQVIAD
FT                   PMMSTVFGVGIESGTSPLGYRYLLPTQFLPTHGEKICIR"
     atgacgcaac tgacgttaaa gcacgtcggc gtcacgcttc ataaacgccc actgctcacc        60
     gatatttctc taacgtggcc tgcggcacag gtgagcggca ttattggccc caatggggcg       120
     ggcaaatcca cgttactcaa agccattaac cacatggtcc ccattaccgg gcagatcgaa       180
     tatcaacagt gcccactgaa tacgcgcgtc acacgcatcg cctatgtgtc ccaactcaat       240
     cgtagtgatt ctgccctgac cgtttttgaa atggtcctgc tgggtaaagt tcgccaattg       300
     agctggcgtg tcagccccgc acaaattgat gcggtcgagc aggtattggc agagtgcggc       360
     atttcctctc tggcaaacca agttttcaac agtctaagtg gcgggcaacg ccagttagtg       420
     atgctcgcgc aggctttcat cgctcagccg cagatcattt tgctggatga accgaccagc       480
     gccctggata ttcaccacca attacgtgtg ctgcaaaaaa tcgtcgatta cagcaaacgc       540
     caccaatgca ccacattaat ggtgatccac gatctgggct tggcgctgcg cttttgccaa       600
     acgctcacgt taatccaccg tggaaatgtt gcctgtcatg gcgcagccca tcaggtgatc       660
     gcggacccca tgatgtccac cgtatttggt gtgggtatcg aaagtggaac aagccctttg       720
     ggctatcgct acttattgcc cactcagttc ttacctactc atggagagaa aatatgtata       780
     cgttga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page