(data stored in ACNUC9543 zone)

EMBL: CP000308.PE631

CP000308.PE631       Location/Qualifiers
FT   CDS_pept        720067..720864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12600"
FT                   /db_xref="GOA:A0A0E1NNR8"
FT                   /db_xref="InterPro:IPR004298"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNR8"
FT                   /protein_id="ABG12600.1"
FT                   /translation="MYTLMKADVLAQLAGLQQEISQLHDNAQQNQSHFVLLERRFSRLQ
FT                   SFNDEPQLQDYRLQLEHDDAVVKQIAQLRQVANAALCDYEKHQVCALCSPSSKTDDYLT
FT                   SFNQSLQQEIKLAGMQMGEKVLLVGSGALPTTALVLVAKLGATVFCYDHDPAAQQLARQ
FT                   LVQSLGLEKQVQFIDNLKELTDRPVDHIIVASLVADKQALLAQLVPYVTRSSKLVMRYG
FT                   NGLKSIFNCPYCHEVNCSHWRTASKPVTTGLYDLIILEPNHHA"
     atgtatacgt tgatgaaagc cgatgtgctg gctcaactcg cggggctgca gcaagaaatc        60
     agccagttac acgataatgc ccagcaaaat cagtctcatt ttgtgttgtt agagcgccgt       120
     tttagtcgct tgcagtcttt taatgacgag ccacagctac aagattaccg gttgcagttg       180
     gagcacgatg atgcggtggt aaaacaaatt gcccaattgc ggcaggtcgc caatgcggca       240
     ctgtgtgact atgaaaaaca tcaggtatgc gccttgtgta gcccatcctc caagactgac       300
     gactacctga caagttttaa ccaatcgctg caacaagaga tcaaactcgc cggtatgcag       360
     atgggtgaga aggtgttgtt ggtgggcagc ggtgccttgc cgaccacggc gctggtactg       420
     gttgccaagc tcggtgcaac cgtcttttgc tacgatcacg atcccgccgc acagcagtta       480
     gctcgccagc tcgttcaatc cctcggtctg gaaaaacagg tgcaatttat tgataacctg       540
     aaagagttaa cggaccgtcc cgttgaccac attatcgtcg cttcattggt ggcggataaa       600
     caggcgttat tagcacaatt ggttccctat gtgacccggt ccagcaaatt agtgatgcgc       660
     tatggcaatg ggctgaagtc tattttcaac tgcccttatt gccatgaggt gaactgttca       720
     cattggcgca ccgccagtaa accggtgacc accgggcttt atgaccttat cattttggaa       780
     cctaatcatc atgcataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page