(data stored in ACNUC9543 zone)

EMBL: CP000308.PE633

CP000308.PE633       Location/Qualifiers
FT   CDS_pept        722224..723069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0634"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12602"
FT                   /db_xref="GOA:A0A0E1NLX6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLX6"
FT                   /protein_id="ABG12602.1"
FT                   /translation="MNQGALLAILASLIFSVMNVLVKTIADEIPTGEIVFFRSSIGCLL
FT                   IGLLMYQRGIAFSREDRPLLVLRGTMGALYLICYFYSIAHLTLADASMLAYLSPFFSIV
FT                   LSLLVLRERVNATMAFWLVMVIIGAIILIRPWNFSTYTLASLVGVMSAVFAAIAYLSVN
FT                   KLTKRHHNYEIVFYFLFITTLISIPLMWHNFVWPSGYQFGILIAIALVSLLGQVVLTQA
FT                   FSSDNLIVVSVVRYIGIVFNITWGWLFWDEVPLMLSLMGGGLVVVSCIQLGLRSKKKAA
FT                   "
     atgaaccaag gcgcgttatt ggctattctc gcctccctga ttttcagcgt gatgaatgtg        60
     ttagtcaaaa ccatcgctga tgaaattcct accggtgaga tcgtattctt ccgcagtagc       120
     attggttgct tgttgattgg gttactgatg tatcagcgtg ggatagcgtt cagccgtgaa       180
     gatcgcccat tgttggtact ccgggggacg atgggcgcac tgtatctgat ttgctatttt       240
     tacagtattg ctcacctgac attggcagat gccagcatgt tggcctatct gtcaccgttt       300
     ttctcgattg tgctgtcatt attagtgttg cgcgaacggg tgaatgccac catggctttc       360
     tggttggtga tggtgattat tggcgcgatt atcttgatcc gcccgtggaa tttttccacc       420
     tatacgttgg cgtctctggt gggggtgatg agtgcggtat ttgcggctat tgcttatttg       480
     tcggtgaata agctcacgaa gcgccatcac aattatgaaa tcgtcttcta ctttttgttt       540
     atcacgacgc tgatctctat cccactgatg tggcataact ttgtttggcc gagtgggtat       600
     cagttcggca ttctcatcgc cattgctctt gtctcattgc taggtcaggt ggttttaacg       660
     caggctttct cttcggacaa cctgatcgtg gtgtcggtgg tgcgctatat cggcattgtc       720
     ttcaatatta cctggggctg gctattttgg gatgaggtgc cattgatgtt gtcgttgatg       780
     gggggcgggt tggtggtggt atcgtgcatt cagttggggt tacgcagtaa aaagaaggcg       840
     gcctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page